KEGG   Xenopus laevis (African clawed frog): 100049086
Entry
100049086         CDS       T01010                                 

Gene name
aifm2.S, aifm2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2 S homeolog
  KO
K22745  apoptosis-inducing factor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100049086 (aifm2.S)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA DAO K_oxygenase AlaDh_PNT_C Lycopene_cycl HI0933_like FAD_binding_2 NAD_binding_8 FAD_binding_3 Amino_oxidase Thi4 FAD_oxidored Trp_halogenase NAD_binding_7 DUF4147
Other DBs
NCBI-GeneID: 100049086
NCBI-ProteinID: NP_001091397
Xenbase: XB-GENE-1003379
UniProt: Q6GLW8 A0A1L8FF64
LinkDB
Position
7S
AA seq 374 aa
MGSKVSVEESVRVVIVGGGFAGIAAASQLKSFGIPFLLVDMKDAFHHNVAALRACVESGF
ARKTFISYKDSFHDSFKQGKVVGINLQTQLVILESNEELSFSHLIIATGSNGPFPGKFNE
VISKDQAIQIYENLVEEIQKAKHVVVVGGGSAGVEMAAEVKTDYPEKEVTLIHSKIALAD
VQLQPSVRRTVKEILLRKGVRLILAQKVTNLDQVTPNVAQENMELQLDKDSEVVNCDLVL
CCIGLKVSSSSYRSALGDKMAEDGSLIVNDYLQVQGHENVYAVGDCAYINEPKMAYYAGI
HARVAATNVRNSLIGKSLKSYIPGALSMLLSMGRNDGVGQFNGYYLGRCFVTMAKSRDIF
VSKSWKEMGQTMPR
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggatccaaggtctcagtggaagaatccgtacgagtggtgattgttggtggagggttt
gccggtattgctgctgccagtcagctgaaatcctttggaattccttttctgttagttgat
atgaaagatgcatttcatcataatgtagctgctcttcgtgcttgtgtagagagtggcttt
gcaagaaaaacgttcatatcctataaggattccttccatgacagctttaaacaaggcaaa
gtggttggaataaatcttcagacccaacttgtgattttagaaagcaatgaggagctttcg
ttttctcacctcatcattgcaactgggagtaatgggcccttccccggcaagtttaatgaa
gtcatctctaaagaccaagctattcagatatatgaaaatctggttgaagagattcagaag
gctaagcatgtggtggtagtgggtggaggttctgcaggagtcgagatggcggctgaggtt
aagactgattatccagaaaaagaggtcactttaatccattccaaaattgcattagcagat
gttcagctgcaaccaagtgtcagaagaactgtgaaggaaatcctgttgagaaagggtgtc
agactaattctggcacaaaaagtcaccaatttggaccaagtgactccaaatgttgcccaa
gagaacatggagttgcagttggacaaggactcggaggtggtaaattgtgaccttgtttta
tgttgcattggattgaaggtcagttcctcaagttacagaagtgctttgggtgacaaaatg
gcagaagacggttcccttatagttaatgactaccttcaggtgcaaggacatgaaaatgtt
tatgcagttggggactgtgcatatattaatgaacccaagatggcatattatgctggcatt
catgccagagtggcagcaaccaatgttcggaacagcctgattgggaaatcacttaaatcc
tacataccaggggctctttctatgcttctttcaatgggacgaaatgatggcgtcggacag
ttcaatggatattatttaggtcgttgtttcgtgaccatggctaaaagccgtgatattttt
gtttcaaagagctggaaggaaatgggccaaacgatgcctcgttaa

KEGG   Xenopus laevis (African clawed frog): 108696268
Entry
108696268         CDS       T01010                                 

Gene name
aifm2.L
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2 L homeolog
  KO
K22745  apoptosis-inducing factor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108696268 (aifm2.L)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 K_oxygenase GIDA DAO AlaDh_PNT_C HI0933_like Trp_halogenase NAD_binding_8 Lycopene_cycl Thi4 FAD_binding_3 Amino_oxidase FAD_binding_2 NAD_binding_7 FAD_oxidored DUF3236
Other DBs
NCBI-GeneID: 108696268
NCBI-ProteinID: XP_018080977
Xenbase: XB-GENE-17332348
UniProt: A0A1L8FK51
LinkDB
Position
7L
AA seq 374 aa
MGAKVSVDESVRVVIVGGGFAGIAAASQLKSFGIPFLLVDMRDAFHHNVAALRASVESGF
ARKTFISYKETFQDNFKQGKVVGINLQTQLVTLESNEELPFSHLIIATGSNGPFPGKFNK
VIPKDHAIQLYEDLVKEIQKAKHVVVVGGGSTGVEMAAEVKTDYPEKEVTLIHSKVALAD
VQLQPSVRKTVKEILLRKGVRLILAQKVTNLNQVTPNVAQENIELQLEKNSEVVTCDLVL
CCTGFNISSSSYSSAFGDKMAEDGSLKVNEYLQVEGHANVYAVGDCAFINEPKMAYNAGI
HARVAATNVRNSLIGKSLKTYIPGAVSMLLSMGRNDGVGQFNGFYLGSFFMIMYKSGDIF
VSKSWKDMGQVMPR
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggagccaaggtctcggtggatgaatcggtacgagttgtaattgttggtggaggtttt
gcgggtatcgctgctgccagtcagctgaaatcctttggaattccttttctgttagttgat
atgagggatgcatttcatcataacgtagctgctcttcgtgcttctgtagagagtggcttt
gcaagaaaaactttcatttcctataaagagacctttcaagacaacttcaaacaaggcaaa
gtggttggaataaatcttcagacccagctcgtgactttagaaagcaatgaggaacttcca
ttttctcacctcatcattgcaactgggagtaatgggcccttccctggcaagtttaataaa
gtcatccccaaagaccatgctattcagctgtatgaagatctagttaaagagattcagaag
gctaagcatgtggtggtagtcggaggtggatctacaggagttgagatggcggctgaggtg
aagactgattatccagaaaaagaggtcactttaattcattccaaggttgctttagcagat
gttcaactgcaaccaagtgtcagaaaaactgtgaaggaaatcctgttgagaaagggtgtc
cgactaatccttgcacaaaaagtcaccaatttgaaccaagtgactccgaatgttgcccaa
gagaacatagagttgcagctggaaaagaactctgaggttgtaacttgtgaccttgtttta
tgttgcactggatttaatatcagctcctcgagttacagtagtgcttttggcgacaaaatg
gcagaagacggctcccttaaagtcaatgagtatcttcaggtggaaggacatgccaatgtt
tatgcagttggggactgtgcatttattaatgaacccaagatggcatataatgcaggcatt
catgccagagtggcagcaaccaatgttcggaacagcttgattgggaagtcacttaaaaca
tacataccaggggctgtttctatgcttttgtcaatgggacgaaatgatggagtcggacag
ttcaatgggttttatttaggtagtttttttatgatcatgtacaaaagtggggatattttt
gtttcaaagagctggaaggatatgggccaagtgatgcctcgttaa

DBGET integrated database retrieval system