KEGG   Xenopus laevis (African clawed frog): 100049768
Entry
100049768         CDS       T01010                                 

Gene name
serpine1.S
Definition
(RefSeq) serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 S homeolog
  KO
K03982  plasminogen activator inhibitor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100049768 (serpine1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100049768 (serpine1.S)
   04218 Cellular senescence
    100049768 (serpine1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    100049768 (serpine1.S)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    100049768 (serpine1.S)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    100049768 (serpine1.S)
Peptidases and inhibitors [BR:xla01002]
 Peptidase inhibitors
  Family I4: serpin family
   100049768 (serpine1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100049768 (serpine1.S)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100049768 (serpine1.S)
SSDB
Motif
Pfam: Serpin rve_3
Other DBs
NCBI-GeneID: 100049768
NCBI-ProteinID: XP_018095163
Xenbase: XB-GENE-17342203
LinkDB
Position
5L
AA seq 398 aa
MSHNIRCMLVLLLSLTLVASAQNRISCVAQKSTSFGLRLFQEVLEDQQGKNLGFSPYGVT
SALSVLQSGAAGKTLDQIQKALNFGQKEWAVALSLHKLREQISGQQKSTEDPKPVHIADG
LFVQRHLSLTPGFLERFQATFHRQVSQVNFTDAAQAKDIINQWVENKTDGMIKDLVGSNN
IPPLTRLVLLSAVHFSGKWTVPFPEKATRQRPFYRSDGSHVQVQMMANTGKYNYSEFTTL
DGDFYDVIELPYEGEELSMLIAAPYEKNVPLSAITNILTPELIAQWKAQMKKVTRLIVLP
KFSLLSEVDLKKPLERLGMTDMFTEETADFSRLSSEKPLYVSEAFQKIKVEVTERGTRAS
AATAAILLARMAPLEVILDHPFLFMVRHNPTGEINTML
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcacacaacataaggtgcatgctggtcctcttactttccctgacattggtcgcttct
gcccaaaacagaatatcttgtgtggctcagaaaagcacgagttttgggttacgtttgttt
caagaggttcttgaagaccaacagggaaagaacctgggcttctcgccttatggggtaaca
tccgccttgagtgtccttcagtctggagcagccggaaaaacattggatcagatccaaaaa
gctctcaattttggacagaaagaatgggcagtggccttgtcacttcataagctgcgggag
cagatttccggacaacaaaaatctactgaagaccccaagccagtacacattgcagatggt
ctctttgtacagcggcacctatcactgactccagggttcctcgaaagatttcaagcaact
tttcaccgacaagttagccaggtcaactttactgatgcagcccaagccaaggatatcata
aatcaatgggtagaaaacaagacagatggaatgatcaaagatttagtgggaagcaacaac
atacctccactgacccgcctcgtgctattaagtgctgtacacttcagtggaaaatggact
gtcccattcccagaaaaggcaactcgccagcgcccattctacagatctgatgggtctcat
gtgcaagttcaaatgatggccaacactgggaaatacaactacagtgagttcacgacccta
gatggggatttttatgatgtgatagagctgccatatgaaggagaggagctcagcatgctt
attgctgctccttatgaaaaaaatgttcccttatccgccatcaccaacatcctgacacct
gagctcattgcccagtggaaagcccaaatgaagaaagtaacacgtcttatagtcctaccc
aagttctctctgcttagtgaagtagatctaaagaagcctctagaacgtctggggatgact
gacatgttcactgaagagacagcagactttagccgcttatcctctgaaaaaccactatat
gtatctgaagctttccaaaaaatcaaagttgaagtgacagaaaggggtacaagagcatct
gcagcaacagctgctatcctgctagcccgaatggctcctctggaggtcatcctggaccat
cctttcttgttcatggtcagacacaacccaacaggtgagataaatactatgctatag

KEGG   Xenopus laevis (African clawed frog): 779433
Entry
779433            CDS       T01010                                 

Gene name
serpine1.L, serpine1
Definition
(RefSeq) serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog
  KO
K03982  plasminogen activator inhibitor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    779433 (serpine1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    779433 (serpine1.L)
   04218 Cellular senescence
    779433 (serpine1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    779433 (serpine1.L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    779433 (serpine1.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    779433 (serpine1.L)
Peptidases and inhibitors [BR:xla01002]
 Peptidase inhibitors
  Family I4: serpin family
   779433 (serpine1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   779433 (serpine1.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   779433 (serpine1.L)
SSDB
Motif
Pfam: Serpin PrlF_antitoxin
Other DBs
NCBI-GeneID: 779433
NCBI-ProteinID: NP_001090520
Xenbase: XB-GENE-969642
UniProt: Q0IHE4
LinkDB
Position
3L
AA seq 403 aa
MSYNIRCMLVFLLSLTLVTSAQNRISRVAQKGTRFGLRLFQEVLVDQRGKNLGFSPYGVM
SALTVLQSGAAGKTLDQIRKALNFGQKEWAVALSLHKLRVQISRQQKSTEDPKPVHVADG
LFVQRDLSLTPGFLQKFQATFHRHVSQINFTDAAQAKDIINQWVEKKTDGMIKDLVGSNN
IPPLTRLVLLSAIHFSGKWTVPFPEKATHQRPFYRSDGSHVIVQMMANTGKYNYGEFTTP
DGDFYDVIELPYEGEELSMIIAAPYEKGVPLSTITNILTSELIVQWKAQMKKVARLLVLP
KFSLLSEVDLKKPLERLGITNMFTEEMADFSRLSSEKPLYVSEAFQKIKVEVTERGTRAS
AATAAILLARMAPLEVIMDHPFLFMVRHNPTGTLLFVGQVMEP
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtcatacaacataaggtgcatgctggtcttcttactttccttgacactggtaacttct
gcccaaaatagaatatctcgcgtggctcagaaaggcacacgttttgggttacgtttgttt
caagaggttcttgtagaccaacgggggaagaacctgggcttctcgccttatggggtaatg
tccgccttgaccgtccttcagtcaggagcagctgggaaaacattggatcagatccgcaaa
gctttaaattttggacagaaagaatgggcggtggccttgtcacttcataagctgagggta
cagatctccagacaacaaaaatctactgaagaccccaagccagtacacgttgcagatggt
ctctttgtacagcgggacctgtcactgaccccagggttccttcaaaaatttcaagcaact
ttccaccgacatgttagccaaatcaattttactgatgcagcccaagccaaggacatcatt
aatcaatgggtagagaaaaaaacagatggtatgatcaaagatttagtggggagcaacaac
atacctccactgacccgtcttgtgctattaagtgctatacacttcagtggcaaatggact
gtcccattcccggagaaggcaacacaccagcgcccattctacagatctgatgggtctcac
gtgattgtgcaaatgatggccaacactgggaaatacaactacggtgagttcacaacccca
gatggggatttttatgatgtgatagagctgccatatgaaggagaggagctcagcatgatt
attgctgctccttatgaaaaaggtgttcccttatccaccatcaccaacatcctgacatct
gagctcattgtccagtggaaagcccaaatgaagaaagtagcacgacttctagtcctaccc
aagttctctctgcttagtgaagtagatctgaagaagcctctagaacgtctgggaattact
aacatgttcactgaagagatggcagacttcagccgcttgtcctctgaaaaaccactatat
gtttctgaagcttttcaaaaaatcaaggtggaagtgacagaaaggggtacgagagcatct
gcagcaacagctgctatcctgctagctcgaatggctcctctggaggttatcatggaccat
cctttcttgttcatggtcagacacaacccaacaggtacactgctattcgtgggacaagtc
atggagccctga

DBGET integrated database retrieval system