KEGG   Xenopus laevis (African clawed frog): 100127310
Entry
100127310         CDS       T01010                                 

Gene name
prkag3.S, prkag3, prkag3-a
Definition
(RefSeq) protein kinase, AMP-activated, gamma 3 non-catalytic subunit S homeolog
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100127310 (prkag3.S)
   04068 FoxO signaling pathway
    100127310 (prkag3.S)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100127310 (prkag3.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100127310 (prkag3.S)
   04920 Adipocytokine signaling pathway
    100127310 (prkag3.S)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100127310
NCBI-ProteinID: NP_001106348
Xenbase: XB-GENE-6078209
UniProt: A9JS54
LinkDB
Position
9_10S
AA seq 340 aa
MEVMEQEESQQEPIFFGTGPPLYEAPDLGEDAGLYMEFMMKNCCYDAIPTSCKLVVFDTT
LQIKKAFLALVANGVRAAPLWDSKQHCFVGMLTITDFINILHRYYKAPLVQIYELEEHKI
ETWREVYLQSSFKPLIYISPADSLFHAVYSLIKNKIHRLPVMDPVSGNILHILTHKRLLK
FLHLFGDTLTRPRFLQKTILELGIGTFRDVAVVQDTSSVYNALEIFVERRVSALPVVNES
GQVVGLYSRFDVIHLAAQKIYNNLNISVRDALRLRSLSIEGVLMCYPHESLEVVIDRIVR
EQIHRLVLVDEERRPRGIVSLSDILQALVLTPAGIDRNSL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaagtgatggagcaagaagagtctcagcaggagcccatcttctttggaacaggacct
cctctgtatgaagccccagatctgggggaagatgctggcctttacatggagttcatgatg
aaaaactgctgttatgacgccattcctactagctgcaagttggttgtgtttgacaccaca
ctacagataaagaaggcgttcctggcactggtggccaatggagtacgggcagcccccctt
tgggacagcaaacaacactgctttgtgggtatgctcaccatcaccgacttcattaacatc
ctgcacagatactacaaggcgcccttggttcagatatatgaactggaggagcataaaata
gagacatggagagaggtgtacctgcaaagttctttcaagccattaatctatatctcccca
gcagacagccttttccatgccgtgtattcactcatcaagaataaaatccaccggctgcca
gtaatggatcccgtatccgggaacatcctgcatatcctcacacacaaacgcttactcaag
ttcctccacctctttggtgacactctcactaggccgcggtttttgcagaagaccatcctg
gagctcggcattggcaccttcagggatgtagcagtagtgcaggacacgtcttctgtctac
aatgcactggaaatatttgtagagaggagagtttctgccctccctgtggtgaatgaatct
gggcaggtggttggactatattctcgcttcgatgtaatacatcttgcagcacagaagatc
tataacaacctgaatatcagtgtgcgagatgctctgcgcctgcgcagcctgtctattgag
ggggttctcatgtgttacccccatgaaagtctggaggtggtcattgatcgaattgtacga
gaacagattcatcggctggttctggtagatgaagagcgtcgtcctcggggtattgtgtct
ctgtctgacattctgcaagcgttggtgctcactcccgcaggtattgatcgcaattccttg
tga

KEGG   Xenopus laevis (African clawed frog): 108714249
Entry
108714249         CDS       T01010                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108714249
   04068 FoxO signaling pathway
    108714249
   04150 mTOR signaling pathway
    108714249
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108714249
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108714249
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108714249
   04920 Adipocytokine signaling pathway
    108714249
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108714249
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108714249
   03029 Mitochondrial biogenesis [BR:xla03029]
    108714249
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108714249
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108714249
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    108714249
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108714249
  Mitophagy factors
   Other mitophagy factors
    108714249
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 108714249
NCBI-ProteinID: XP_018113776
UniProt: A0A1L8GM16
LinkDB
Position
4L
AA seq 551 aa
MAEKQKHDGRVKIGHYILGDTLGVGTFGKVKMGEHQLTGHKVAVKILNRQKIRNLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
AATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFIDESSLHIP
SGVKPHPERMPPLIADNPKPRCPLDALNTTKPKPLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNPYHLRVRRKNPVTGTYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQK
SGSSTPQRSCSAAGLHRPRLSIDSTTSDYSAPSGPLFGSFSSSFSLVNSRLGSHTMDFFE
MCASLITTLAR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgatggacgggttaaaataggacactacatcttgggggac
acgctaggagttggcaccttcggaaaagtgaaaatgggtgaacatcagctgacagggcac
aaggttgcagtgaaaatattaaacagacaaaaaattcgtaacctggatgttgttggcaaa
ataaagagagagatacaaaatctaaagctttttcggcaccctcacataattaaattatac
caagtcattagcactccaacggattttttcatggtcatggagtatgtctctgggggagaa
ttgtttgactatatctgcaaacatggaagggttgaagaagcagaggcacgacgccttttt
caacagatcatttctgctgtagattactgtcacagacatatggtggttcaccgtgatctg
aaaccagagaatgtgctgcttgatgcacacatgaatgccaagatagctgattttggatta
tctaacatgatgtcagatggggaatttctgcgtaccagttgcggctctccgaactatgca
gcaccggaagtcatatcaggaagattgtatgcaggtcctgaggtggatatctggagctgt
ggagttatactctatgctctgctctgtggaactctaccatttgatgatgagcatgtgcca
acactttttaagaagataagaggaggagtattttacatccctgagtaccttaaccgctct
gctgctacattgttaatgcatatgctacaagttgaccctctcaagcgtgccaccatcaaa
gacataagagaacatgaatggtttaaacaggatttacccagttacttgtttccagaagac
ccatcatacgatgccaatgtaattgatgatgaggctgtgaaggaagtgtgtgagaaattt
gaatgtacggaatccgaagtcatgaacagtttatacagcggtgacccgcaagaccagctt
gctgttgcctaccaccttataatagacaatcgaagaataatgaaccaggccagtgaattc
tacctcgcctctagtccgccaactggctcattcatagatgaaagctctttgcacatcccg
tctggggtgaagccacacccagaaagaatgccacccctaatagcagataatcccaaacca
agatgtcctctagatgctttgaacaccacaaagcctaaacccctagctgtgaaaaaagcc
aagtggcacttggggatccgcagtcaaagtaaaccgtatgatattatggctgaagtttac
agagctatgaagcaacttgattttgaatggaaggtagttaatccatatcatctccgtgtg
agaagaaagaatccagtgactggtacttatgtgaaaatgagtctgcagctctaccaggtc
gataatcgcagttaccttctggactttaaaagtattgatgatgaagtcatggaacaaaag
tcaggttcttcaacccctcagcgttcttgctctgcagctggcctgcacagaccacgcctg
agtattgactcaaccacatcagactattcagcgccaagtggacctctctttggctctttc
tcaagcagttttagtttagttaactctcgcttgggcagccataccatggatttctttgaa
atgtgtgccagtctgattacaacgctggctcgttaa

KEGG   Xenopus laevis (African clawed frog): 108715541
Entry
108715541         CDS       T01010                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108715541
   04068 FoxO signaling pathway
    108715541
   04150 mTOR signaling pathway
    108715541
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108715541
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108715541
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108715541
   04920 Adipocytokine signaling pathway
    108715541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108715541
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108715541
   03029 Mitochondrial biogenesis [BR:xla03029]
    108715541
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108715541
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108715541
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    108715541
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108715541
  Mitophagy factors
   Other mitophagy factors
    108715541
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 108715541
NCBI-ProteinID: XP_018116279
UniProt: A0A1L8GFI4
LinkDB
Position
4S
AA seq 551 aa
MAEKQKHDGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRNLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVPGGELFDYICKHGRVEETEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
AATLLMHMLQVDPLKRATIKDIREHDWFKQDLPSYLFPEDPSYDANVVDDEAVKEVCEKF
ECTELEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFIDESTLHIP
PGVKPHPERMPPLIADSPKARCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMVEVY
RAMKQLDFEWKIVNPYHLHVRRKNPVTGTYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQK
SGSSTPQRSCSAAGLHRPRLSIDSTTSDYSAPSGPLFGSFSGSFSLVNPRLGSHTMDFFE
MCASLITALAR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgatggacgggttaaaataggacactacatcttgggggac
acgctaggagttggcaccttcggaaaagtgaaaattggtgaacatcagctgacagggcat
aaagttgcagtgaaaatattaaacagacaaaagattcgtaacttggatgttgttggcaaa
ataaagagagaaatacaaaatcttaagctttttcggcacccacacataatcaaattatac
caagtcattagcactccaacggatttttttatggtcatggaatatgtccctgggggagaa
ttgtttgactatatctgcaaacatggaagggttgaagaaacagaggcaagacgccttttt
caacagatcatttctgctgtagattactgtcacagacatatggtggttcaccgcgatctg
aaaccagagaatgtgctgcttgatgcacacatgaatgccaagatagctgattttggattg
tctaacatgatgtcagatggggaattcttgcgtaccagttgtggctctcccaattatgca
gcaccagaagtcatatcaggaagattgtacgcaggtcctgaggtggatatctggagctgt
ggagtgatactctatgctttgctctgtggaactctaccatttgatgatgaacatgttcca
acactttttaagaaaataagagggggagtattttacatccctgagtaccttaaccgctct
gctgctacattattaatgcatatgctacaagttgaccctctcaagcgtgccaccatcaaa
gacataagagaacatgactggtttaaacaggatttacccagttacttgtttccagaagac
ccatcgtatgatgccaatgtagttgatgatgaggctgtgaaggaagtgtgtgagaagttt
gaatgtacagaattagaagttatgaacagtttatacagtggtgacccacaagaccagctt
gctgtcgcctaccaccttataatagacaatcgaaggataatgaaccaggccagtgaattc
tacctcgcctctagtccaccaactggctcattcatagatgaaagcactttgcacatcccc
cctggggtgaagccacacccagaaagaatgccacctctaatagcagatagtcccaaggca
agatgtcctctagatgctttgaacaccaccaagcctaaacccctaactgtgaaaaaagcc
aagtggcacttgggaatccgcagtcaaagtaaaccatatgatattatggttgaagtttat
cgagccatgaagcaacttgattttgaatggaagatagttaatccttatcatctccatgtg
agaagaaagaatccagtgactggtacttacgtgaaaatgagtttgcagctgtaccaggtt
gataatcgcagttatcttctggactttaaaagtattgacgatgaagtaatggaacaaaaa
tcaggttcttcaacccctcaacgttcttgctctgcagctggcctgcacagaccgcgcctg
agtattgattcaaccacatcagactattcagcgccaagtggacctctctttggctctttc
tcaggcagttttagtttagttaaccctcgcttggggagccataccatggatttctttgaa
atgtgtgctagtctgattacagcactggctcgttaa

KEGG   Xenopus laevis (African clawed frog): 108715739
Entry
108715739         CDS       T01010                                 

Gene name
prkab2.S
Definition
(RefSeq) protein kinase, AMP-activated, beta 2 non-catalytic subunit S homeolog
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108715739 (prkab2.S)
   04068 FoxO signaling pathway
    108715739 (prkab2.S)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108715739 (prkab2.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108715739 (prkab2.S)
   04920 Adipocytokine signaling pathway
    108715739 (prkab2.S)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 108715739
NCBI-ProteinID: XP_018116653
Xenbase: XB-GENE-17344663
UniProt: A0A1L8GGU2
LinkDB
Position
4S
AA seq 271 aa
MGNTASDRISGDRHGKSHRADGATGGHSTKEHEENKIMVGSTDDPNIFSTQESKHPSDST
WPQDSEDPGKSYQQGRPTVIRWTESGKEVFISGSFNNWTAKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSDTSARDL
SSSPPGLYGQELYAYKPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDGIMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggtaacactgcaagtgaccgcatttctggagatcggcatggcaagtcccaccgtgca
gatggagcaactgggggacactcaacaaaggagcatgaggaaaacaaaatcatggtcgga
agcacagatgacccaaatatctttagcactcaagaatccaagcaccctagtgactcaaca
tggccccaggactcagaggatcctgggaaatcatatcagcagggtcgtcctactgtaatc
cgttggacagaaagtggaaaagaagtcttcatatctgggtcattcaacaactggactgcc
aaaatcccactgattaaaagccacaatgactttgttgccattttggaccttccagaggga
gagcatcagtacaagttttttgtggatgggcaatgggtacatgacccttctgagcctgtg
gtcaccagccagcttggtacaatcaacaacttgatccatgttaaaaagtcggattttgaa
gtatttgatgctttaaaactggattcaatggaaagttctgacacatcagctagagacttg
tcaagttccccccctggactttatggccaagagttatatgcctacaagccagaagaacga
tttaaatcacctcctatccttcctccccatcttctccaagttatacttaacaaagatacc
aacatctcttgtgatcctgcgctccttccagaacccaatcacgtcatgctaaaccacctg
tatgctttgtcaataaaggatgggataatggttcttagtgcgacccatcgctataagaag
aagtatgtcaccactttactgtacaagccaatttag

KEGG   Xenopus laevis (African clawed frog): 108715919
Entry
108715919         CDS       T01010                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108715919
   04068 FoxO signaling pathway
    108715919
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108715919
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108715919
   04920 Adipocytokine signaling pathway
    108715919
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI
Other DBs
NCBI-GeneID: 108715919
NCBI-ProteinID: XP_018116972
UniProt: A0A1L8I0A7
LinkDB
Position
1L
AA seq 266 aa
MGNTSSERPVPHKVRSDSTGAATKGEDRAKILMDSPEDADMFPAEESKGSTEKDEFLAWQ
HDLEVNDKMPSQARPTVFRWTGGGKEIYLSGTFNNWTKIPLIRSHNNFFAILDLPEGEHQ
YKFLVDGQWTHDPAEPVITNQLGTVNNIIQVQKTDFEVFDALMVDSQKGSDISDLSSSPP
GPYQQDPYNCKLEERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSI
KDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggaaacacaagcagtgagcgacccgttccccacaaggtgcggagtgatagtactggg
gcagcgactaaaggggaagacagagctaaaatattgatggatagccctgaggatgcggac
atgttccctgcggaggagagtaagggttccacagaaaaggatgagtttctggcttggcag
catgatttagaagtaaatgataaaatgccttctcaagccagaccaactgtattccgctgg
actggaggcggcaaagaaatctatttatcagggacctttaacaactggacaaaaattcca
cttataagaagccacaacaacttttttgcaatattggatcttccagagggagaacatcag
tacaagttcttggtcgatggccagtggacccatgatccagcagagccagtaattacaaat
cagctgggcactgtaaacaacattatccaagttcaaaaaacagactttgaagtatttgat
gccctaatggtggattctcaaaaaggctctgacatatcagatttatccagctctccccct
ggaccttaccagcaagatccatataactgtaaactagaggaacgattcaaaacacctcct
atccttccaccacatttgcttcaagtcattcttaataaagacacaggcatatcatgtgac
ccagcattgcttccagaacctaaccatgtgatgttaaatcatctctatgccctttcaatt
aaggatggtgtgatggtgctaagtgcaacccaccgttacaagaagaaatatgttaccaca
ttgctatacaaaccaatatga

KEGG   Xenopus laevis (African clawed frog): 108718729
Entry
108718729         CDS       T01010                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108718729
   04068 FoxO signaling pathway
    108718729
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108718729
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108718729
   04920 Adipocytokine signaling pathway
    108718729
SSDB
Motif
Pfam: CBS DUF3086
Other DBs
NCBI-GeneID: 108718729
NCBI-ProteinID: XP_018122610
LinkDB
Position
6L
AA seq 556 aa
MGSTVMDTKKKKDLPRKPSSQKKKMLRVHIPDLSSFAMPFLDGDLDNAEKNSQRKAEEPC
STGSPSKSFFPRGLQNRPSSPLSAPVKTKYSPGSPKTVFPFPYQESPPRSPRRMSFSGIF
RSSSKDSPSPNPSTSPGGIRFFTRSRKASGLSSSPSTPTQVTKQPTFPLESYKHEPERLE
ARLRSYSSPPDTGQRFSLPHLPVTVTKSSIVSSSLSATSRTAHSTTEGMLDKLELEDEAV
EESESDIYTRFMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKNQS
FVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNIFPDACLFDA
VYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVSEMPKPAFMKQNLEELGIGTY
HNIAFIHPHTPIIKALNIFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDIT
VTQALEHRSQYFEGVVKCSKPETLETIVDRIVKAEVHRLVVVDEADSIVGIISLSDILQA
LVLSPAGAKRKESEAE
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgggaagtacagtcatggacaccaagaagaaaaaggatctgcccaggaagccctccagc
cagaagaagaagatgctgagagtccacatccctgatctcagttcctttgctatgcccttt
ttggatggagatttggataatgcagagaaaaattcccagcgcaaggcagaggagccttgc
agcactgggagtccttccaaaagctttttcccccgaggcctccaaaaccggccgtcgagt
ccattatcagccccggtaaaaaccaagtacagccctggctctcccaagaccgtctttccc
ttcccatatcaggagtccccccctcgctccccgcgtcggatgagcttcagcggcatcttc
agatcttcctccaaagattctccttctcccaacccatctacctcacctgggggcatccga
ttcttcacaaggtcaaggaaagcctcaggactctcctcctccccatccactcccacacaa
gtgaccaagcagcccacctttcccctggaatcctacaaacatgagccagaacggttagag
gccagactgcgctcgtactcctcacccccagacaccggacagaggttttcattacctcac
ttgcccgtaactgtgacaaagtcctccattgtgtcatcatccctcagcgctacctcaaga
acagctcacagcaccactgaaggcatgctggataaactagagctggaagatgaagctgtt
gaagaatcagagagtgacatatatacacgcttcatgaaatcacacaagtgctacgacatt
gtcccgaccagctccaaacttgtcgtattcgacactacgttacaagtaaagaaggctttt
tttgccttggtagccaatggcgtacgcgctgctcctctatgggaaacgaaaaaccagagt
tttgtaggtatgttaacaattacagatttcattaatatattgcatcgatattacaagtct
cccatggtacagatttatgagctagaagagcacaagatcgagacgtggagggagctgtat
ttacaggagacgttcaagcctctagtgaacatatttccggatgcatgtctcttcgatgca
gtatattcattgataaaaaataaaatccacagattgcctgttattgacccagtcagtgga
aatgcactttatatacttacccacaagagaatcctcaagttccttcagctttttgtgtca
gaaatgccaaagcctgccttcatgaaacaaaatttagaggagctggggatcggcacatac
cacaacattgccttcattcatcctcacactcctattattaaagctttgaatatatttgtg
gagagaagagtctcagcgttaccagtggtggatgagtctggaaaagttgtagatatttat
tccaaatttgatgtcattaacctcgctgctgagaaaacctacaataatctggatatcacg
gtgacgcaggcccttgaacaccgatcgcagtatttcgaaggcgtggtgaagtgcagtaag
ccggagacactggagaccattgtggatcgaatagtcaaggcagaggtgcacagactggta
gttgtagatgaagcagacagcattgtgggaattatctctctctcagacattctacaggcg
ttagtgctttctccagcaggtgccaaaaggaaggagagtgaagcagaatga

KEGG   Xenopus laevis (African clawed frog): 380124
Entry
380124            CDS       T01010                                 

Gene name
prkag3-b
Definition
(RefSeq) protein kinase, AMP-activated, gamma 3 non-catatlytic subunit b
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    380124 (prkag3-b)
   04068 FoxO signaling pathway
    380124 (prkag3-b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    380124 (prkag3-b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    380124 (prkag3-b)
   04920 Adipocytokine signaling pathway
    380124 (prkag3-b)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 380124
NCBI-ProteinID: NP_001080432
UniProt: A0A1L8EVT4 Q7ZYL2
LinkDB
Position
9_10L
AA seq 340 aa
MEVMEQEESQQVPIFFGAGPPLYEAPDLGEDASLYMEFMMKNCCYNAIPTSCKLVVFDTT
LQIKKAFLALVANGVRAAPLWDSKQHCFVGMLTITDFINILHRYYKAPLVQIYELEEHKI
ETWRDVYLQSSFKPLIYISPADSLFQAVYSLIKNKIHRLPVMDPVSGNILHILTHKRLLK
FLHLFGDTLPRPQFLQKTILELGIGTFRDIAVVQDTSSVYNALEIFVERRVSALPVVNES
GQVVGLYSRFDVIHLAAQKIYNNLDISVLDALRLRSLCIEGVLMCYPHESLEVVIDRIVR
EQIHRLVLVDEERRPLGIVSLSDILQALVLTPAGIDRNSL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaagtgatggagcaagaggagtctcagcaggtgcccatcttctttggagcaggacct
cccttgtatgaagccccagatctgggggaagatgccagcctttacatggagttcatgatg
aagaattgctgttacaatgccattcctactagctgcaagttggtcgtgtttgacaccaca
ctccagataaagaaggcgttcctggcacttgtggccaatggagtacgggcagctcccctc
tgggacagtaaacaacactgctttgtgggtatgctcaccatcaccgacttcattaatatc
ctgcacagatactacaaggcgcccttggttcagatatatgaactggaggagcacaaaata
gaaacatggagagacgtgtacctgcaaagttctttcaagccattaatctatatctcccca
gcagacagccttttccaagctgtgtattcactcatcaagaataagatccaccggctacca
gtaatggatcccgtatctggcaacatcttgcatatcctcacgcataaacgcctactcaag
ttccttcacctctttggtgacactctgcctaggccacagttcttgcagaagaccatcctg
gagctgggcatcggcactttcagggatatagcagtagtgcaggacacttcttctgtctac
aatgcactggaaatctttgtagagaggagagtttctgccctccctgtagtgaatgaatct
gggcaggtggttggactatattcccgcttcgatgtaatacatcttgcagcacagaagatc
tataacaacctggatatcagtgtgctagatgctctgcgcttgcgtagcctgtgtatcgag
ggggtcctcatgtgttatccccatgaaagtctggaggtggtcattgatcgaattgtacga
gaacagattcatcgcctggttctggtggatgaagagcgtcgtcctctgggtattgtgtct
ctctctgacattcttcaagcgctggtgctcactcccgcaggtattgaccgcaattccttg
tga

KEGG   Xenopus laevis (African clawed frog): 380372
Entry
380372            CDS       T01010                                 

Gene name
prkab2.L, prkab2
Definition
(RefSeq) protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    380372 (prkab2.L)
   04068 FoxO signaling pathway
    380372 (prkab2.L)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    380372 (prkab2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    380372 (prkab2.L)
   04920 Adipocytokine signaling pathway
    380372 (prkab2.L)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 380372
NCBI-ProteinID: NP_001080680
Xenbase: XB-GENE-976421
UniProt: Q7SZ97
LinkDB
Position
4L
AA seq 271 aa
MGNTASDRISGDRHGKSHRADGATAGHSTKEHEENKIMVGSTDDPNIFSTQESKHPGDST
WTQDSEDPGKSSQQGRPTVIRWTEGGKEVFISGSFNNWNTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSDTSARDL
SSSPPGLYGQELYAYKPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggtaacactgcaagtgatcgcatatctggagatcggcatggcaagtcccaccgtgca
gatggagcaactgcgggacactctacaaaggagcatgaggaaaacaaaatcatggttgga
agcacagacgacccaaatatctttagcactcaagaatctaagcaccctggagactcaaca
tggacgcaggactcagaggatccagggaaatcatctcagcagggtcgtcccactgtaatc
cgttggacagaaggtggcaaagaagtcttcatatctgggtcattcaacaactggaataca
aaaattccactgattaaaagccacaatgactttgttgccattttggaccttccagaggga
gagcatcagtacaagttttttgtggatgggcaatgggtacatgacccttctgagcctgtg
gtcaccagccagcttggtacgattaacaacttaatccatgtgaagaagtcagattttgaa
gtatttgatgctttgaaactggattcaatggaaagttctgacacgtcagctagagacttg
tcaagttccccccctggactttatggccaagagttatatgcctacaagccagaagaacgc
tttaaatcacctcctatccttcctccccatcttctgcaagttattcttaacaaggatacc
aacatctcttgcgatcctgcgctccttccagaaccaaatcacgtcatgctaaaccacctg
tatgctttgtcaataaaggatggggtaatggttcttagtgcgacccatcgatataagaag
aagtacgtcaccactttattgtacaagccaatttag

KEGG   Xenopus laevis (African clawed frog): 398958
Entry
398958            CDS       T01010                                 

Gene name
prkag1.S, prkag1
Definition
(RefSeq) protein kinase, AMP-activated, gamma 1 non-catalytic subunit S homeolog
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    398958 (prkag1.S)
   04068 FoxO signaling pathway
    398958 (prkag1.S)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    398958 (prkag1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    398958 (prkag1.S)
   04920 Adipocytokine signaling pathway
    398958 (prkag1.S)
SSDB
Motif
Pfam: CBS Cbl_N3 DUF3086
Other DBs
NCBI-GeneID: 398958
NCBI-ProteinID: NP_001083495
Xenbase: XB-GENE-1010729
UniProt: Q6PA60
LinkDB
Position
6S
AA seq 558 aa
MGSTVMDTKKKKDLPRKPSSQKKKMLRVHIPDLSSFAMPFLDGDLDNAEKNSQRKAEEPC
STGSPSKSFYPRSLQNQPSSPVSAPVKMKCSPGSPKTVFPFPNQESPPRSPRRMSFSGIF
RSSSKDSSSPNSNPSTSPGGIRFFTRSRKTSGLSSSPSTPTQVTKQPIFPLESYKHEPER
LEARLRSYSSPPDTGQRFSLPHLPITVTKSSVVSSSLSATSRTAQSTTEGMLEKLELEDE
AVEESESDIYTRFMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKH
QSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNIFPDASLF
DAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVSEMPKPAFMKQNLEELGIG
TYHNIAFIQPHTPIIKALNIFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLD
ITVTQALEHRSQYFEGVVKCSKPETLETIVDRIVKAEVHRLVVVDEADSIVGIISLSDIL
QALVLSPAGAKRKESEAE
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgggaagtacagtcatggacaccaagaagaaaaaggatctgcccaggaagccctccagc
cagaagaagaagatgctgagagtccacatccctgacctcagttcctttgctatgccgttt
ttggatggagatttggataatgcagagaaaaattcccagcgcaaggcagaggagccttgt
agtactggaagcccatccaaaagcttttacccccgaagcctccaaaaccagccatcgagt
ccggtatctgccccggtcaaaatgaagtgcagccccggatctcccaagaccgtctttccc
ttcccaaatcaggagtccccccctcgctccccccgtcggatgagcttcagcggcatcttc
agatcttcctccaaagattcttcttctcccaactccaacccgtctacctcacctggcgga
atccgattcttcacaagatcgaggaaaacttcaggactctcctcctccccatccactccc
acacaagtgaccaagcagcccatcttcccccttgaatcctacaaacatgagccagaacgg
ttagaggccagactgcgctcttactcctcacctccagacactggacagaggttttcatta
cctcacttgcccataactgtgacaaagtcctcagtcgtgtcatcatccctcagcgctacc
tcaagaacagctcaaagcaccactgaaggcatgctggagaaactagagctggaagatgaa
gctgttgaagaatccgagagtgacatatatacgcgcttcatgaaatcacacaagtgctac
gacattgtcccgaccagctccaaacttgttgtattcgacactacgttacaagtaaagaag
gctttttttgccttggtagccaatggcgtaagagctgctcctctatgggaaacaaaacac
cagagttttgtaggtatgttaacaattacagatttcattaatatattgcatcgatattac
aagtctccaatggtacagatttatgagctagaagagcacaagattgagacttggagggag
ctgtatttacaggagacgttcaagcctctagtgaacatttttccagatgcaagtctcttc
gatgccgtgtattcattgataaaaaataaaatccacagattgcctgttattgacccagtc
agtggaaatgcactttatatacttactcacaaaagaatcctcaagttccttcagcttttt
gtgtcagaaatgccaaagcctgccttcatgaaacagaatttagaggagcttgggatcggc
acataccacaacattgccttcattcagccccacactcctattattaaagctttgaatata
ttcgtggagagaagagtctcggcgttaccagtggtggacgagtctggaaaagtcgtagat
atttattccaaatttgatgtcattaacctcgctgctgagaaaacctacaacaatctggat
atcacagtgacgcaggccctcgaacaccgatcgcagtatttcgaaggagtggtgaagtgc
agtaagccggagacactggagacaattgtggatcggatagttaaggcagaggtgcacaga
ctggtagtcgtagatgaagcagacagcattgtgggaattatctctctctcagacattcta
caggccttagtgctttccccagcaggtgccaaaaggaaggagagtgaagcagaatga

KEGG   Xenopus laevis (African clawed frog): 399172
Entry
399172            CDS       T01010                                 

Gene name
prkaa2.S, ampk, ampk2, prkaa, prkaa1, prkaa2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit S homeolog
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    399172 (prkaa2.S)
   04068 FoxO signaling pathway
    399172 (prkaa2.S)
   04150 mTOR signaling pathway
    399172 (prkaa2.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    399172 (prkaa2.S)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    399172 (prkaa2.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    399172 (prkaa2.S)
   04920 Adipocytokine signaling pathway
    399172 (prkaa2.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    399172 (prkaa2.S)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    399172 (prkaa2.S)
   03029 Mitochondrial biogenesis [BR:xla03029]
    399172 (prkaa2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     399172 (prkaa2.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   399172 (prkaa2.S)
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    399172 (prkaa2.S)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    399172 (prkaa2.S)
  Mitophagy factors
   Other mitophagy factors
    399172 (prkaa2.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like Kdo RIO1 APH
Other DBs
NCBI-GeneID: 399172
NCBI-ProteinID: NP_001083882
Xenbase: XB-GENE-6486573
UniProt: Q8UVW8
LinkDB
Position
1S
AA seq 560 aa
MRRLSSLMKMAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVAGGELFDYICKNG
KLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPPVISLLKHMLLVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSTNMID
DEALKEVCDKCECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FMEEPPISRPHPERVPFLIAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPND
IMAEVCRAMKQLGYEWKLVNPYYLRVRRKNPVTSMCTKMSLQLYQVDSRTYLLDFRSIDD
EVTESKSESATPRRSGSISNYRPPRNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLLPRP
GSHTIEFFEMCANLIKILAR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcgcaggctcagttcgctcatgaagatggcggcggataaacagaagcatcatgacggg
agggtgaagatcggtcactatattctgggcgacacgcttggggtgggcacgtttggcaaa
gtgaaagttggcaaacatgagctgacgggacacaaggttgcagtgaagattttaaaccgg
cagaagatccgcagcctcgatgtggttgggaaaattcgccgcgagatccagaacctgaag
ctcttccggcatcctcatattattaagctgtaccaggtcatcagcacgccaactgatatc
tttatggttatggaatatgttgctggcggggaactctttgattatatttgcaagaatggc
aagttggatgaaaaggaatcccggcgcttgttccagcaaattctttctggcgttgattat
tgccatagacatatggttgtacacagagacttgaagcctgagaatgttctcctcgatgcc
cacatgaatgcaaagattgcagattttgggctctctaacatgatggctgatggtgaattc
ctacgaactagctgtggctcccctaactatgctgcaccggaagttatttcaggaagactt
tatgctggcccagaggtggacatatggagctgcggggttatcctatacgctttactctgc
ggaactcttccgtttgatgatgatcacgtgccaacactttttaagaagatatgtgacggc
atcttctacacaccccagtacctgaatcctcccgtcattagccttctaaagcacatgcta
ttggtcgatcccatgaagagagcaacgattaaagatattcgggaacacgaatggttcaag
caagatcttcccaaatatctgtttcccgaggacccatcgtacagtacaaatatgatcgat
gacgaagccttaaaggaagtgtgtgataagtgtgagtgtacggaggaggaagtgctgagc
tgcttgtacagtcgcaaccaccaggatccattagccgtcgcctaccatctgatcatagat
aatcgcaggataatgaacgaggccaaagacttctatttggcaactagtcctccggattcc
ttcatggaagagcctcctatatcccggcctcacccagagagagtgccctttttaatagcg
gagtcgcctcggcaacggcacacactcgatgagttgaacccgcaaaagaccaaacaccaa
gttggtgtaagaagagccaaatggcatcttggcattcgaagtcagagccgaccaaatgat
attatggccgaggtttgccgagcaatgaaacaactgggctatgaatggaagcttgtgaat
ccttactacctgcgtgtgagaaggaagaacccagtgactagcatgtgcactaagatgagc
ctccagctgtaccaagtggatagcagaacttacctgctggatttccgcagcattgacgat
gaagttactgaatccaagtcggaaagcgccacccctaggagatcaggctccattagcaat
taccgacctccaagaaacgactcggatcctgaaattcaagcaaagtcttcagacggctca
gggccgtcctccttaacctcatcagtggactcttccaacgccgacttactccccaggcct
ggaagccataccatcgaattttttgaaatgtgcgcaaatctaataaaaatcctcgcacga
taa

KEGG   Xenopus laevis (African clawed frog): 443998
Entry
443998            CDS       T01010                                 

Gene name
prkab1.S, prkab1
Definition
(RefSeq) protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    443998 (prkab1.S)
   04068 FoxO signaling pathway
    443998 (prkab1.S)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    443998 (prkab1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    443998 (prkab1.S)
   04920 Adipocytokine signaling pathway
    443998 (prkab1.S)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI DUF4758
Other DBs
NCBI-GeneID: 443998
NCBI-ProteinID: NP_001085572
Xenbase: XB-GENE-970886
UniProt: Q6GPZ3
LinkDB
Position
1S
AA seq 266 aa
MGNTSSERPVPHKVRRDSTGAASKGEDRAKILMDSPEDADMFPVGESKGSAEKDEFLAWQ
HDLEVNDKIPSQARPTVFRWTGGGKEIYLSGTFNNWAKIPLIRSRNNFFAILDLPEGEHQ
YKFLVDGQWTHDAAEPVITSQLGTVNNVIQVQKTDFEVFDALMVDSQKVSDLSDLSSSPP
GPYQQDPYNCKLEERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSI
KDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 801 nt   +upstreamnt  +downstreamnt
atggggaacacgagcagtgaacgacccgttccccacaaggtgcgaagagatagcactggg
gcagcgtccaaaggggaagacagagctaaaatattaatggacagccctgaggatgcggac
atgttccctgtgggggagagtaagggttccgcagaaaaggatgaatttctggcttggcag
catgatttagaagtaaatgataaaattccctctcaagccagaccgactgtattccgctgg
actggaggcggcaaagaaatctatttatcggggacctttaacaactgggcaaaaatccca
cttataaggagccgcaacaacttttttgcaatattggatcttccagagggagaacatcag
tacaagttcttggttgatggccagtggacccatgatgcagctgagccagtaataaccagc
cagcttggcacagtaaacaatgtcattcaagttcaaaaaacagactttgaagtatttgat
gccctgatggtggattcccaaaaagtttctgacttatcagatttatccagctctccgcct
gggccttaccagcaagatccatataactgtaaactagaggaacgctttaaaacaccccct
atccttccaccacacctgcttcaagtcattcttaataaagacacaggcatttcctgtgac
ccagcattgcttccagaacctaatcatgttatgttaaatcatctgtatgccctttcaatt
aaggatggtgtgatggttctaagtgcgacccaccgttacaagaagaaatatgttaccaca
ttgctgtacaaaccaatatga

KEGG   Xenopus laevis (African clawed frog): 444397
Entry
444397            CDS       T01010                                 

Gene name
prkag2.L, prkag2
Definition
(RefSeq) protein kinase, AMP-activated, gamma 2 non-catalytic subunit L homeolog
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    444397 (prkag2.L)
   04068 FoxO signaling pathway
    444397 (prkag2.L)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    444397 (prkag2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    444397 (prkag2.L)
   04920 Adipocytokine signaling pathway
    444397 (prkag2.L)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 444397
NCBI-ProteinID: NP_001085968
Xenbase: XB-GENE-943602
UniProt: Q6GN94
LinkDB
Position
2L
AA seq 334 aa
MEPGSVMIETNMQEKCEPASDVLESESGVYTRFMKNHKCYDLIPISSKLVVFDTSLQVKK
AFFALVTNGVRAAPLWDSKMQGFVGMLTITDFINILHRYYKSSMVQIYELEEHKIETWRE
LYLQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLF
MSELEKPGFVTKSLKDLRIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVD
IYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHR
LVVVDENDVAKGIVSLSDILQCLVLTAGGEKSLI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggaaccgggttccgttatgatcgaaactaacatgcaggagaaatgtgagcctgcttca
gatgttctggaatcagaaagtggagtttacacgaggttcatgaagaatcacaaatgctat
gatcttattcccatcagctcaaagcttgttgtttttgatacttccctgcaggtgaagaaa
gcattcttcgctctagtaactaatggggtaagagctgcaccactctgggatagcaaaatg
caaggctttgtaggcatgctaaccataactgacttcatcaatattctccatcgctactac
aagtcatccatggtgcagatttatgagctggaggaacataaaattgagacctggagagag
ctctacttgcaggattcctttaagcctctggttagcatttcacccagtgcaagtctgttt
gatgcagtctcatcactgataaagaaccggatacaccgtcttcctgtcatctctcctgac
tcagggaatactctatacatcctgacacacaaacgaatcctgaaattccttaagcttttt
atgtctgaacttgagaaacctggttttgtgaccaaatctctaaaggatctgcgcattggc
acttatgaaaatattgcccttgttcgcccagacactcctgtgtatgttgctttgggcatc
tttgtgcagcggcgggtgtctgctttgccagttgtggatgactcaggacgcgttgttgat
atatattccaagtttgatgtcattaatctggcggctgagaagacgtacaataaccttgac
atcacagtgaccaaagctctcggccatcgttcccattacttcgaaggtgtgctgaaatgt
taccagcatgaaacgcttgaaactatcatcaaccggctagtagaagcagaggttcaccgg
ctggttgtggttgatgagaatgatgtagccaaagggattgtctcgctttcagacatatta
cagtgtttagttttgacagctgggggcgaaaagagcttaatttaa

KEGG   Xenopus laevis (African clawed frog): 495290
Entry
495290            CDS       T01010                                 

Gene name
prkaa1.L, ampk, ampka1, prkaa1
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    495290 (prkaa1.L)
   04068 FoxO signaling pathway
    495290 (prkaa1.L)
   04150 mTOR signaling pathway
    495290 (prkaa1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    495290 (prkaa1.L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    495290 (prkaa1.L)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    495290 (prkaa1.L)
   04920 Adipocytokine signaling pathway
    495290 (prkaa1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    495290 (prkaa1.L)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    495290 (prkaa1.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    495290 (prkaa1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     495290 (prkaa1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   495290 (prkaa1.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    495290 (prkaa1.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    495290 (prkaa1.L)
  Mitophagy factors
   Other mitophagy factors
    495290 (prkaa1.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like Kdo RIO1 APH
Other DBs
NCBI-GeneID: 495290
NCBI-ProteinID: NP_001088426
Xenbase: XB-GENE-946198
UniProt: Q5U5E3
LinkDB
Position
1L
AA seq 560 aa
MRRLSSLMKMAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKHG
KLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPPVISLLKHMLLVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSTNMID
DEALKEVCDKCECTEEEVLSCLYSHNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FMEDPPIARPHPERVPFLVAESPRQRHTLDELNPQKSKHQVGVRRAKWHLGIRSQSRPND
IMAEVCRAMKQLVYEWKVVNPYYLRVRRKNPVTSMYTKMSLQLYQVDSRTYLLDFRSIDD
DVTEAKSESATPRRSGSISNNRPPKNESDPEFQAKSSDGSGPSSLTSSVDSSNTDLVPRP
GSHTIEFFEMCANLIKILAR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcgcaggctcagttcgctcatgaagatggcggcggataaacagaagcatcatgacggg
agggtgaagatcggtcactacattctgggagacacgcttggggtgggcacgtttggcaaa
gtaaaagttggcaaacatgaattgactggacacaaggttgcagtgaagattttaaaccgg
cagaagatccgcagccttgatgtggttgggaaaattcgccgcgagatccagaatctgaag
ctcttcaggcatcctcatatcattaagctgtaccaggtcatcagcacgccaactgatatc
tttatggttatggagtatgtttctggcggggaactctttgattatatttgcaagcatggc
aagttggatgaaaaggaatcccggcgtttgttccagcaaattctttctggcgttgactat
tgccatagacatatggttgtacacagagacttgaagcctgagaatgttctcctcgatgcc
cacatgaatgcgaagattgcggattttggcctctctaacatgatggctgatggggaattc
ctacgaaccagctgtggctcccctaattatgctgccccagaggttatttcaggaagactt
tatgctggtccagaggtggacatatggagctgtggggtcatcctatacgctttactctgt
ggaactcttccttttgatgacgatcacgtgccaacactttttaagaagatatgtgacggc
atcttctacacaccccagtacctgaatcctcccgtgattagccttctaaagcacatgctg
ttggtggatcccatgaaaagggcaaccattaaagatattagggaacacgaatggttcaag
caagatcttcctaaatatctgtttccggaggacccatcctacagtacaaatatgatcgac
gatgaagccttaaaagaagtgtgtgataagtgtgagtgcacggaagaagaagtgctgagc
tgcttgtacagtcacaaccatcaggatccattagcagtcgcctaccatctgatcatagat
aatcgcaggataatgaatgaggccaaagacttctatttggctaccagtcctccggattcc
ttcatggaagatcctcctatagctcggcctcacccagagagagtgccctttttagtggcc
gagtcacctcggcaacggcacactctcgatgagttaaacccgcaaaagtccaaacaccag
gttggggtaagaagagccaaatggcatcttggtatacgaagtcagagccgaccaaatgat
atcatggctgaggtttgccgagcaatgaaacagttggtctatgagtggaaggttgtaaat
ccctactacctgcgcgtgagaaggaagaatccggttactagcatgtacaccaagatgagc
ctccagctgtaccaagtggatagcagaacttacctgctggatttccgtagcattgacgat
gacgttactgaagccaagtcagaaagcgccacccctaggagatccggctccattagcaat
aaccgacctccgaaaaacgaatctgatcctgaatttcaagcaaagtcttcagacggctca
gggccgtcctctttaacctcatccgtggactcttccaataccgacttagtccccaggcct
ggaagccataccatagaattttttgaaatgtgtgcaaatctaataaaaatccttgcacga
tag

DBGET integrated database retrieval system