KEGG   Xenopus laevis (African clawed frog): 100158422
Entry
100158422         CDS       T01010                                 

Gene name
rfwd2.L, rfwd2
Definition
(RefSeq) ring finger and WD repeat domain 2, E3 ubiquitin protein ligase L homeolog
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100158422 (rfwd2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100158422 (rfwd2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    100158422 (rfwd2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100158422 (rfwd2.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100158422 (rfwd2.L)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100158422 (rfwd2.L)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4_4 WD40_like zf_C2H2_10 zf-rbx1 Prok-RING_4 zf-RING_10 zf-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 100158422
NCBI-ProteinID: XP_018113967
Xenbase: XB-GENE-1014316
LinkDB
Position
4L
AA seq 681 aa
MSSSRQSQQLPGPGGGTGPSSSSAPSSSSSAGTLRPGLVSGSALSRLGTGGSGSALVGRP
GSSAGRKRPLPTPLSNGLINSYEDKSNDFVCPICFEMIEEAYMTKCGHSFCYKCIHQSLE
DNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFDDKRLKLDPSNGHRWQIFHDLLGAD
QDNLDLANVNLMLQLLVQKKRQLEAESHAAQLQILMEFLIVARRNKREQLEQIQKELSVL
EEDIKRVEEMSGLYSPQSEDSTVPQFEAPSPSHSLIDSTEYSQSPGFSGSSQTKKQPWYN
STLASRRKRLTAHFEDLEQCYFSTRMARVSDDSRTASQLDEFQECLSKFTRYNSVRPLAT
LSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTCN
SKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLA
SGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQ
PIMVFKGHRKAVSYAKFVNGDEIVSASTDSQLKLWNVSRPHCLRSFKGHINEKNFVGLAS
NGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPD
GESNVLIAANSQGTIKVLELV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgtcctcaagtcggcaatctcagcaactccccgggcccggaggtggaacgggcccctct
tcgtcatcagccccgtcttcttcttcttcagcgggtacattgcggcctggactagtcagt
ggctccgctctcagccgactcggaactggaggcagtggatccgcgttagtgggaaggccg
gggagctcagctggtaggaagaggcctttgcctacacctctgtctaatggcctcattaac
tcctacgaggacaagagtaacgatttcgtgtgcccaatatgctttgaaatgattgaggaa
gcatacatgactaaatgtggacacagtttctgctataagtgtatccatcaaagcctggag
gacaataaccgctgtccaaagtgtaactatgtggtagacaatatagatcatctctatcct
aactttttagtaaatgagttaatcctcaaacagaagcaaagatttgatgataagcgtctg
aagctggatccatcgaatgggcacaggtggcagatattccacgatttactaggggcagac
caagataatctggatttggccaatgtaaatctaatgctgcagctgcttgtccagaaaaaa
aggcaattggaggctgaatcccatgctgctcagctgcagatccttatggaatttctcatt
gtagctcgccgaaataaaagagagcaactggagcaaattcaaaaggagctaagtgtactg
gaagaggacataaagcgcgtggaggaaatgagtggcttgtattcccctcagagtgaagat
agtactgtgccacaatttgaagctccttctccttcccacagcctgattgactcaacagaa
tacagtcaatctccaggattcagtggcagctcccagacaaagaagcaaccatggtacaac
agcaccctggcatcacgaagaaaacgtcttacagcccattttgaggacttggagcagtgc
tacttttcaacaaggatggcacgtgtatcagatgacagtcgaacagcaagtcagttagat
gaatttcaagaatgcctttccaagttcaccagatacaattctgtgcgacctctagcaacc
ctatcttatgccagcgatctctacaatggctctagcattgtgtccagcatagagtttgac
cgagactgtgactactttgccattgctggtgtgacaaagaagataaaggtatacgagtat
ggcactgttattcaggatgctgtggatatacactaccctgagaatgaaatgacctgtaat
tccaaaattagctgtataagttggagcagctatcacaagaacctcctggctagcagtgat
tatgaaggcactgtcatcttatgggatgggttcacagggcaaagatccaaggtgtatcag
gaacatgagaaaaggtgttggagtgttgattttaatcttatggatcccaaactcctggcc
tccggttcagatgatgccaaagtaaagctgtggtccacaaacttggataactctgttgca
agtattgaagccaaagcaaatgtatgctgtgttaagttcagcccctcctctcgctaccat
ctagccttcggttgtgcagatcactgtgtccactattatgaccttcggaacactaagcag
cccattatggtgttcaaagggcatcgcaaagcagtctcctatgccaaatttgtaaatggg
gatgagatagtctcagcgtcaacggatagtcagttgaaattgtggaatgtgtcaaggcca
cattgtcttcgttcgtttaagggacatattaatgaaaagaattttgttggcttggcatct
aatggagactacattgcttgtggaagtgaaaacaactccctctacctttattataagggt
ctttccaaaaccttgttgactttcaaatttgacacagtcaagagtgttttagacaaggat
aggaaagaagatgacaccaatgaatttgtaagcgccgtgtgctggcgtgcactccctgat
ggggagtcaaatgtacttattgctgctaacagtcagggcacaatcaaggtactggaactg
gtatga

KEGG   Xenopus laevis (African clawed frog): 108715625
Entry
108715625         CDS       T01010                                 

Gene name
rfwd2.S
Definition
(RefSeq) ring finger and WD repeat domain 2, E3 ubiquitin protein ligase S homeolog
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108715625 (rfwd2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108715625 (rfwd2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    108715625 (rfwd2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108715625 (rfwd2.S)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108715625 (rfwd2.S)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     108715625 (rfwd2.S)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4_4 WD40_like zf_C2H2_10 zf-rbx1 Prok-RING_4 zf-RING_10 zf-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 108715625
NCBI-ProteinID: XP_018116435
Xenbase: XB-GENE-17338128
LinkDB
Position
4S
AA seq 682 aa
MSSSRQSQQLPGPGGGAGPSSSSAPSSSSSAGTLRSGLVSGSALSRLGTGGSGSALVGRP
GSSAGRKRPLPTPLCNGLINSYEDKSNDFVCPICFEMIEEAYMTKCGHSFCYKCIHQSLE
DNNRCPKCNYVVDNIDHLYPNFLVNELILKQKHRFDDKRLKLDPSNGHRWQIFQDLLGAD
QDNLDLANVNLMLQLLVQKKRQLEAESHAAQLQILMEFLIVARRNKREQLEQIQKELSVL
EEDIKRVEEMSGLYSPQSEDSTVPQFEAPSPSHSSLIDSTEYSQSPGFSGSSQTKKQPWY
NSTMASRRKRLTAHFEDLEQCYFSTRMARVSDDSRTASQLDEFQECLSKFTRYNSVRPLA
TLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTC
NSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLL
ASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTK
QPIMVFKGHRKAVSYAKFVNGDEIVSASTDSQLKLWNVSRPHCLRSFKGHINEKNFVGLA
SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALP
GGESNVLIAANSQGTIKVLELV
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgtcctcaagccggcaatctcagcaactccccgggcccggaggtggagcgggcccctca
tcgtcctcagccccgtcttcgtcttcttcagcgggtacactgcggtctggactagttagt
ggctccgctctcagccgactcggaaccggaggcagtggatccgcgttagtgggcaggccg
ggaagctcagctggtaggaagaggcctttgcctacacctctgtgtaatggcctcattaac
tcatacgaggacaagagcaacgacttcgtgtgcccaatatgcttcgaaatgattgaggaa
gcatacatgactaaatgtggacacagtttctgctataagtgtatccatcaaagcctggag
gacaataaccgatgtccaaagtgtaactatgtggtagacaatatcgatcatctctatcct
aactttttagtaaatgagttaatcctcaaacagaagcacagatttgacgataagcgtttg
aagctggacccatcgaatgggcacaggtggcagatattccaggatttactaggggcagac
caagataatctggatttggccaatgtaaatctaatgctgcagctgcttgtccagaagaaa
aggcagctggaggccgaatcccatgctgctcagctacagatccttatggaatttctcatt
gttgctcgccgaaataaaagagagcaactggagcaaattcaaaaggaactcagcgtacta
gaagaggacataaagcgcgtggaggaaatgagtggcttatattcccctcagagtgaagat
agtactgtgccgcaatttgaagctccttctccttcacacagtagcctgattgactcaaca
gaatacagccaatctccaggattcagtggcagctcccagacaaaaaagcaaccatggtac
aacagcactatggcatcacgaagaaaacgtctcacagcccattttgaggacttggagcag
tgctacttttcaacaaggatggcacgtgtatcagatgacagtcgaacagcaagtcagtta
gatgaatttcaagaatgcctttccaagttcaccagatataattccgtgcgacctttagca
accctctcttatgccagtgatctctacaatggctctagcattgtgtccagtatagagttt
gaccgagactgtgactattttgccatcgctggtgtgacaaagaagataaaggtatacgag
tatggcactgttattcaggatgctgtggacatacactaccctgaaaatgaaatgacatgt
aattctaaaattagctgtataagctggagcagctaccacaagaacctcctggctagcagt
gattatgaaggtactgttatcttatgggatgggttcacaggacaaagatccaaggtgtat
caggaacatgagaaaaggtgttggagtgttgatttcaatcttatggatcccaaactcctg
gcctctggttcagatgatgccaaagtaaagctgtggtccacaaacttggataactctgtt
gcaagtattgaagccaaagcaaatgtatgctgtgttaaattcagcccctcctctcgctat
catctagccttcgggtgtgcagatcactgtgtccactattatgaccttcggaacactaag
cagcctattatggttttcaaagggcatcgcaaagcagtctcctatgccaagtttgtaaat
ggggatgagatagtctcagcgtcaacagatagtcagttgaaactgtggaatgtgtcacgg
ccgcattgccttcgatcatttaagggacatattaatgaaaaaaattttgttggcttggca
tctaatggagactacattgcttgtggaagtgaaaacaactccctctacctttattataag
ggcctttcaaaaacgttgttgactttcaaatttgacacggtcaagagtgttttagacaag
gataggaaagaagatgacaccaatgaatttgtaagcgctgtgtgctggcgtgcactccct
ggtggggagtcaaatgtacttattgctgctaacagtcaaggcacaatcaaggtactggaa
ctggtatga

DBGET integrated database retrieval system