KEGG   Xenopus laevis (African clawed frog): 100271914
Entry
100271914         CDS       T01010                                 

Gene name
bcl2.S, bcl-2, bcl2, xBcl-2, xbcl2
Definition
(RefSeq) B-cell CLL/lymphoma 2 S homeolog
  KO
K02161  apoptosis regulator Bcl-2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04140  Autophagy - animal
xla04141  Protein processing in endoplasmic reticulum
xla04210  Apoptosis
xla04217  Necroptosis
xla04261  Adrenergic signaling in cardiomyocytes
xla04340  Hedgehog signaling pathway
xla04510  Focal adhesion
xla04621  NOD-like receptor signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100271914 (bcl2.S)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100271914 (bcl2.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100271914 (bcl2.S)
  09143 Cell growth and death
   04210 Apoptosis
    100271914 (bcl2.S)
   04217 Necroptosis
    100271914 (bcl2.S)
   04115 p53 signaling pathway
    100271914 (bcl2.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100271914 (bcl2.S)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100271914 (bcl2.S)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100271914 (bcl2.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100271914 (bcl2.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100271914 (bcl2.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    100271914 (bcl2.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100271914 (bcl2.S)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100271914
NCBI-ProteinID: NP_001139565
Xenbase: XB-GENE-6251434
UniProt: B9ZYL7
LinkDB
Position
6S
AA seq 294 aa
MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWEEGRQQVSAEHPQASAAISNYSDDGEMPAA
SADSRGPPQSSLASAASSDEETPSNTPITFVGNAPAVPRRSASAVSPLAELNVEPRDLNV
NPDASRAADGDNNDADGGDEAVMQPVPSAVLQTLSRAGDEFSRLYQQDFRQISGLLHLTP
STVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVEIVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQDAFVELYNSNIQPPFDQSWLSIKTILSLAVVGACITIGGISLATK
NT seq 885 nt   +upstreamnt  +downstreamnt
atggctcatcctagaagaggaggctatgatcaccgggacatagtggtaaaatatatccat
tataaactatctcagaaggggtatgcatgggaagagggaaggcagcaggtctctgctgag
caccctcaagcttctgctgctattagtaattattctgatgatggagaaatgcctgctgct
tccgcagattcacgtggaccacctcagtcttcactcgcatctgctgcttcctcagatgag
gaaaccccaagtaatactccaataacctttgtgggcaatgcacctgctgttcccaggagg
tctgcatctgctgtttcacccttagctgaattgaatgtcgaaccaagagatcttaatgtt
aatccagatgccagtcgtgctgcagatggtgataataatgatgctgatggtggtgatgaa
gctgttatgcagccagtcccttcggcagtgctacagaccttgagtcgagctggagatgag
ttctctcgcctatatcagcaagatttcagacagatctcagggctcctccatttaacccca
tccacagttagggtgcgctttgcaacagtggtggaggagctctttcatgatggggtaaac
tggggaaggattgttgcttttttcgagtttggtggggtcatgtgcgtggagattgttaac
cgcgaaatgtctcctctggtggactccattgtgggttggatgacagagtacctaaaccgt
cacttacaaaattggatccaggaacaggatgcatttgtggagctgtacaacagcaatatc
cagccaccgtttgaccagagctggttatccatcaagacaatattaagccttgctgtggtt
ggagcctgcatcacaatagggggcatatccttggccaccaaataa

KEGG   Xenopus laevis (African clawed frog): 108719105
Entry
108719105         CDS       T01010                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04140  Autophagy - animal
xla04141  Protein processing in endoplasmic reticulum
xla04210  Apoptosis
xla04217  Necroptosis
xla04261  Adrenergic signaling in cardiomyocytes
xla04340  Hedgehog signaling pathway
xla04510  Focal adhesion
xla04621  NOD-like receptor signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108719105
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    108719105
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108719105
  09143 Cell growth and death
   04210 Apoptosis
    108719105
   04217 Necroptosis
    108719105
   04115 p53 signaling pathway
    108719105
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108719105
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108719105
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108719105
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108719105
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108719105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108719105
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108719105
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 108719105
NCBI-ProteinID: XP_018123221
UniProt: A0A1L8FXP7
LinkDB
Position
6L
AA seq 300 aa
MAHPRRGSYDHREIVVKYIHYKLSQKGYEWEEGRQQVSAEHPQASAAISNYSDDGEMPAA
SADSLGPPQSSLASTAAAASASSDDETPSNTPITFVDNAPAVPRSSASAASPLAELNAVP
RDLNVNPDASRAADGDNNDDGDDEAVMQPVPPAVLQTLIRAGDEFSRLYQQDFRQISGLL
HLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVESINREMSPLVDSIVGWMTE
YLNSHLQNWIQEQGGWDAFVELYNSNIRPPFDPSWLSIKTILSLAVVGACITIGAYLGHK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggctcatcctagaagaggaagctatgatcaccgggagatagtggtaaaatatattcat
tataaactatctcagaaggggtatgaatgggaagagggaaggcagcaggtctctgctgag
caccctcaagcttctgctgctattagtaattattctgatgatggagaaatgcctgctgct
tccgcagattcacttggaccacctcaatcttcactcgcatctactgctgctgctgcttct
gcttcctcagatgacgaaaccccaagtaatactccaatcacctttgtggacaatgcacct
gctgttcccaggagttctgcatctgctgcttcacccttagctgaattgaatgctgtacca
agagatcttaatgttaacccagatgccagtcgtgcagcagatggtgataataatgatgat
ggtgatgatgaagctgttatgcagccagtccctccggcagtgttacagactttgattcga
gctggagatgagttttctcgcttgtatcagcaagatttcagacagatctcagggctcctc
catttaaccccatccacagttagggtgcgctttgcaaccgtagtggaggagctctttcat
gatggggtgaactggggaaggattgttgctttttttgaatttggtggggtcatgtgcgtg
gagagtattaatcgagaaatgtctcctctggtggactccattgtgggttggatgacagag
tacctgaacagtcacttacaaaattggatccaggaacagggaggatgggatgcatttgtg
gagctttacaacagcaatattcggccaccatttgacccaagctggttatccatcaagaca
atattaagccttgctgtggttggagcctgcatcacaataggtgcctatcttggccacaag
tga

DBGET integrated database retrieval system