KEGG   Xenopus laevis (African clawed frog): 100462911
Entry
100462911         CDS       T01010                                 

Gene name
cacna1c.S, ca(v)1.2, cacna1c, cav1.2
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1C subunit S homeolog
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04260  Cardiac muscle contraction
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462911 (cacna1c.S)
   04020 Calcium signaling pathway
    100462911 (cacna1c.S)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100462911 (cacna1c.S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100462911 (cacna1c.S)
   04261 Adrenergic signaling in cardiomyocytes
    100462911 (cacna1c.S)
   04270 Vascular smooth muscle contraction
    100462911 (cacna1c.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    100462911 (cacna1c.S)
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100462911 (cacna1c.S)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel Gag_p17
Other DBs
NCBI-GeneID: 100462911
NCBI-ProteinID: XP_018110313
Xenbase: XB-GENE-6492375
LinkDB
Position
3S
AA seq 2118 aa
MVNENERMYIPEGDHPGSNYTNPLPALGTMNSTPGLAMEHIASPGAALSWQAAIDAARQA
KLMGSTANATISTVSSTQRKRQQYSKQKKQGTTSATRPPRALLCLTLKNPIRRACISIVE
WKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYG
LLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVL
RPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLT
NGYPDVLVDEESSPCALESNNGRHCPNGTVCRSGWAGPKHGITNFDNFAFAMLTVFQCIT
MEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDF
QKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEDKPRNMSMPTSETESVNTDNVGS
GDVEEESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTI
ASEHYNQPEWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGIL
ETILVETKFMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGG
PSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLART
ASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPATKISVEEFSSNENEEKTPY
PSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAVPIPEASAFFIFRSNNRFRLHCHTI
VNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYG
AFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLK
HVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEEECKGKYISY
KDGDVSQPMIVDRSWENNKFDFDTVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIY
NHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKA
RPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNM
LFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNPGEHAQCSSSMN
VEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAV
IGMQVFGKIALNDTTSLNRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPNKPCAPESE
TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIW
AEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNAT
LFALVRTSLCIKTDGNLDQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYAT
FLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVGYYQSEVRSGFPQTFTTQRPLHINKTSGGPGDLD
SPSHEKLVDSTFTPSSYSSSGSNANINNANNTALVLLPCYRSTVSTVEGQSRPVASRGSW
KLGSKSSVSRDSRLPIISREEASQDETYDASEEVEYNSEPSLLCSEMFSDQDEESRQLTP
SEGEVERGLCLSPKKGFLRSASLGRRASFHLECLRRYRHQGAETSSPKTVLPQLHLVHHQ
ALAVAGLSPLLRRSHSPTAFSRLCSTPPATPRPRGGWTQQTVPMLRLHGEPGSRENLNSS
FPSIHCSDCSIERNRPTSLTVPCHPREQGRQHHGSASSLVEAVLISEGLAQFAQDPRFLQ
VATHELADACDMTIEEMETAADSFLNGKASPNGKPSPFSNRRDQGLDCAGGGSEETGLSP
EYQDSDEQEDCRVYVSSL
NT seq 6357 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacgagaggatgtacattccagagggagaccacccaggttccaactac
acaaacccactgccggcacttggcaccatgaactctacccccggcctggcaatggagcat
atcgcctctccaggtgctgctctgtcctggcaggccgccatagatgcagcacgccaggcc
aagcttatgggcagcacagctaacgccaccatatccacagtcagctccacacagagaaag
aggcagcagtacagcaagcagaaaaagcaagggaccacctcagccacgaggcctccccgg
gcgttgctctgtttgaccctgaaaaaccccatccgccgagcctgcatcagtatcgtagag
tggaaaccatttgaaattattattttactgactatctttgccaactgtgtggccttagct
gtctacatccctttcccagaggatgattccaacgctacgaactccaatctggaacgggta
gaatatctcttcctcatcattttcacagtggaagccttcctaaaagtcatcgcatatggg
cttctgttccaccccaacgcttacctccgcaatggctggaatctgctggatttcatcatt
gtagtagtagggctttttagtgctattttagagcaggccacaaaggcagatgggggcagc
gccattggagggaaaggagccggatttgacgtgaaagctcttcgggcgttcagagtcttg
agacccctaaggctggtgtctggagtccccagtctccaggtggtgctgaattccattatt
aaggccatggttccgctgctgcacatcgctctgctggtgctgtttgtcattattatctat
gctataatcgggctggagctgttcatgggcaaaatgcacaagacctgctactatctgaca
aatggatatccagatgtccttgtagatgaagaatcctcgccgtgcgcattggagagcaat
aatgggcggcactgtcccaatggcactgtgtgcagatctggttgggcgggacccaaacac
ggtatcacgaatttcgacaactttgcatttgccatgctcactgtcttccagtgcatcacc
atggagggctggactgatgttctctactggatgcaggacgcaatgggatacgaactgccc
tgtgtgtacttcgtcagcctcgtcatcttcggatcttttttcgttctgaacctggttctt
ggtgtcctgagtggtgagttttccaaagagagagagaaggccaaggctcgaggcgacttc
caaaagctgagggagaagcagcagctggaggaggacctgaaaggctacttggactggatc
actcaggctgaggacatagatccagagaatgaagatgaagatatagacgaagataagcct
cgaaatatgagcatgccaaccagtgaaacggagtcggttaatacagacaacgtgggcagt
ggcgacgtggaagaggagagctgcggagtgcgtctcgcgcacaggatttccaagtctaaa
tttagtcgatactggcgacgatggaaccggttttgcaggaggaagtgtcgggcggctgta
aaatcaaacgtcttttattggctggttatatttcttgtgtttctgaacacgctgaccatt
gcttccgagcactacaaccaaccggaatggcttaccgaggtgcaagacacggccaacaaa
gtgctcctggctctcttcacagcagagatgcttctcaaaatgtacagccttggccttcaa
gcctactttgtttccctgtttaatcgctttgactgcttcatcgtttgcggtgggatcttg
gagaccatattggtagaaactaagttcatgtcgcccctggggatctccgtcctgcgctgt
gtgcgccttctcaggattttcaagattaccaggtattggaactctctgagtaatcttgtg
gcctcgctgctgaattccgtgcgctccatcgcttcccttctcctccttctcttcctcttc
atcatcatcttctcccttctggggatgcaactctttggcggcaaatttaactttgacgag
atgctgacccgcaggagcacgttcgataacttcccacaggctttgcttactgtctttcag
atccttactggggaggactggaactcagtaatgtatgatggtatcatggcttacggggga
ccctcctttcctgggatgcttgtgtgcatttattttatcatcctcttcatctgtggaaac
tatatacttctgaatgtcttcttggccatcgctgtggacaacttggccgatgccgagagt
ctcacttctgctcagaaggaggaggaagaagagaaggagaggaagaaactggcaagaact
gctagccctgagaagaaacaggagaatgagtctctaggaaagtctccagtgccagcggtg
gaggagaacaaagagaagatcgagctgaaggccatcacagctgatggggagtctccaccc
gctaccaagatcagtgtggaagaattttcctcaaatgagaatgaggagaagaccccctat
cccagctccaatgagaccccaggcgaagaggaagaagaagagcctgagatgcctgttggc
cctcgcccaaggcccctttcagagctgcacatcaaggagaaagctgtccctattcccgaa
gcctctgccttcttcatattccgttctaataacaggttccgcctccactgccacacgata
gtcaacaataacatcttcaccaacctcatcctcttcttcatcctcttgagcagcatctct
ctggcagcagaagaccctgtgcgacacaattccttcaggaaccaaatcctaggaaatgct
gattatgttttcactagtatctttactttagaaataatcctcaagatgacggcctatggg
gctttcttacacaaaggctccttctgcaggaactacttcaacatcctggatcttctagtg
gtcagcgtctccctcatctcgttcggaatccaatccagtgccatcaatgtggtgaagatc
ttgcgagtactgagggtgctgaggcctctcagagccattaacagagccaaggggctaaag
cacgtggtacagtgcgtgttcgtggccatccgcaccattggtaacatcgtcattgtcacc
actctgctgcagttcatgtttgcttgtatcggggtacaacttttcaagggtaagttgtac
agctgcactgacagctccaagattacagaggaagagtgcaaagggaagtacatctcctat
aaggatggggacgtctcgcagcccatgatagtggatcggagctgggagaacaacaagttt
gacttcgatactgttctatcagcaatgatggccctcttcactgtctccacatttgagggg
tggccggagcttctctatcgcgccatcgactctcacaccgaagacgtgggtcccatctac
aaccaccgtgtggagatctccatcttttttatcatctacatcatcatcattgccttcttc
atgatgaatatcttcgtgggttttgtcatcgtcacgtttcaggagcagggggagcaggag
tacaagaactgcgagctggacaagaaccagcgtcagtgtgtggagtacgccctgaaagct
cggcccctgaggagatacatacccaaaaaccagtaccagtacaaagtctggtatgtggtc
aactccacctactttgagtacctcatgtttgtgctcattctactcaacaccatctgcctc
gccatgcagcattacgggcagagctgttccttcaaggaagccatgaacatccttaacatg
ttgttcactgggctcttcacggttgagatgatcctgaagcttattgcattcaaaccaaag
ggttattttagtgacccttggaatgtctttgactttctcatcgttattggcagcgtagtt
gacgtcattctcagcgagaccaatccaggtgaacatgcccaatgctcctcctctatgaat
gtcgaggagaattcccgcatctccatcaccttcttcaggctcttccgagtaatgaggctt
gtgaaacttctcagtcgtggagaagggatccggactctgctatggactttcatcaagtct
ttccaggctctcccctatgtagcgctgcttattgtcatgctgttcttcatctacgcggtc
attggcatgcaggtttttggaaaaattgcactaaatgacaccacctcactcaacaggaac
aataattttcagactttccctcaggcagttctgcttctcttcagatgtgccacgggtgaa
gcgtggcaagagattatgctcgcctgtctccctaataagccgtgtgctcccgaatccgaa
accagtgaagaaaagtgtggcagcagctttgccgtcttctattttatcagcttctacatg
ctctgcgccttcttgatcattaatctatttgttgctgtcattatggataattttgactat
ctgacacgggattggtccatattgggccctcatcatttggatgaatttaaacgtatttgg
gcagagtatgatcctgaagccaagggtcgcatcaagcatctggatgtggtgaccctactg
aggaggattcagcccccgctgggctttgggaagctgtgcccacatcgggtggcatgcaag
cgcctagtggctatgaacatgccactgaatagtgatgggacagtcatgtttaatgccaca
ctctttgccctagtaaggacatctttgtgcatcaaaacagatgggaacctggatcaggcc
aatgaagagctgagagccatcatcaagaagatatggaagagaaccagcatgaaacttttg
gaccaggtggtgcctccagctggggatgatgaggtcacggtgggaaagttctatgccacc
tttctgatccaagagtatttccgaaaattcaagaaacgcaaagagcaagggcttgtgggt
aaaccttcccagagaaacgcattgtcactgcaggccggcctgcgcactctgcacgacatt
ggccccgagatccgcagagctatttctggggacctgacagctgaggaggagctggacaag
gcaatgaaggaggccgtgtctgctgcatctgaggatgatatctttaggagggctggaggg
ctctttgggaaccatgttggttattaccagagtgaagtccgaagtgggtttcctcagacc
ttcactacccagcggcctctgcatatcaacaagacgtcgggcggcccaggggatttggac
tctccttcccatgagaagttggtggattctaccttcacccccagcagctactcatcctcc
ggctccaacgccaacatcaacaacgccaataacacggccctggtgctcctgccctgttac
cggagtaccgtgagcaccgtggagggacagagccggcccgtggcctcccgtggctcctgg
aaacttggatctaagagctccgtgtccagagacagccgcctgcctataatctctcgggag
gaggcttcgcaggatgagacgtacgacgccagcgaagaggtggaatataacagcgagccc
agcctgttgtgctcagaaatgttctccgatcaggacgaggaaagccgacagctgaccccc
tcggagggagaagtggagagggggctttgcctgtcccccaagaaaggtttcctgcgttca
gcttctttaggaaggagagcgtcgttccatttggagtgcctgaggaggtatcggcaccag
ggggcggaaacgtcgtcgcccaaaacggtgttgccgcagcttcatctggtgcatcatcag
gcgttagcagtggcgggtctcagccctttactaaggcggagtcactcgcccacagccttc
tcacgtctctgttccacgccgcctgccacgccacgcccccgaggaggctggacacagcaa
accgtgccaatgttacggctgcatggagagccaggctctcgggaaaacctgaacagtagc
tttccttccatccactgcagtgactgtagtatagagcgtaaccgtcccacctcccttaca
gtcccctgccacccacgggagcaaggcaggcagcaccatggcagcgccagcagtttagta
gaagcggtgctgatctccgaagggctggcgcagtttgctcaggacccccgctttctccag
gtagcgacccacgagctggccgacgcctgcgacatgacgatagaggagatggagactgca
gccgacagttttttgaatggcaaggccagccccaacgggaaaccgtcaccattctctaac
cgcagggaccaggggctggactgtgcggggggtgggtcagaggagacaggactctcaccg
gaataccaggacagtgatgagcaggaggactgccgagtgtatgtaagcagcctgtag

DBGET integrated database retrieval system