KEGG   Xenopus laevis (African clawed frog): 100505440Help
Entry
100505440         CDS       T01010                                 

Gene name
pten.S
Definition
(RefSeq) phosphatase and tensin homolog S homeolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00562  Inositol phosphate metabolism
xla01100  Metabolic pathways
xla04068  FoxO signaling pathway
xla04070  Phosphatidylinositol signaling system
xla04115  p53 signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04218  Cellular senescence
xla04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100505440 (pten.S)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100505440 (pten.S)
   04070 Phosphatidylinositol signaling system
    100505440 (pten.S)
   04150 mTOR signaling pathway
    100505440 (pten.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100505440 (pten.S)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100505440 (pten.S)
   04218 Cellular senescence
    100505440 (pten.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100505440 (pten.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    100505440 (pten.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100505440 (pten.S)
    3.1.3.48  protein-tyrosine-phosphatase
     100505440 (pten.S)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100505440 (pten.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100505440 (pten.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 Bac_globin
Motif
Other DBs
NCBI-GeneID: 100505440
NCBI-ProteinID: NP_001184205
Xenbase: XB-GENE-17342770
UniProt: A1L2J3
LinkDB All DBs
Position
7S
AA seq 402 aa AA seqDB search
MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENENVAA
IHCKAGKGRTGVMICAYLLHRRKFPKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL
LKNNLEYRPVPLLFHKMEFETIPMFSSSTCNPQFIVYQLKVKIFTSTAGPKRAEKYMYFD
FPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWVNTFFIPGPEEYSEKVENGTLVGEHELD
GIYSTERSDNDKEYLTLTLTKNDLDKANKDKANRLFSPNFKVKLFFTKTVEESSNSEASS
STSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQITQITKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaggagttcgttagtaggaacaagaggcgctaccaggaggatgga
ttcgacttggacctcacctatatttatccaaacatcattgccatgggctttcctgcagag
aggctggaaggtgtatacagaaataacatcgatgatgtagtgaggtttctggactcgaag
cataaaaatcattacaagatctacaatttgtgtgcagagagacattatgataccaacaaa
tttagctgcagagttgcccagtatccgtttgaagaccacaacccaccacagctagagctc
atcaaacctttctgtgaagatcttgaccagtggttaagtgagaatgagaacgtagcagct
atacattgtaaagccggcaagggtcggacgggggttatgatttgtgcctatttgctacac
agacgcaaatttcctaaagcacaagaagccctagatttttatggagaagtacggaccaga
gataaaaagggagtcacaattcccagccaaaggcgctatgtatattactatagctacttg
ttaaaaaataacctggaatacagaccggtgcccctgctatttcacaagatggagtttgaa
acgattccaatgttcagtagctcaacatgcaatccccagttcatcgtttaccagctgaaa
gtcaagatcttcacttcaacagcaggtcccaagcgagcagaaaagtatatgtattttgat
ttcccccagcctttgcctgtttgcggggacatcaaggtagagtttttccacaaacagaac
aaagtgatgaaaaaggaaaagatgttccatttttgggtaaacacattcttcataccagga
ccggaagagtattcggaaaaagtagaaaacggaacgttggttggggagcatgagcttgat
ggcatctacagtacagagcgttcagataatgacaaggaatatctcaccctcactttaact
aaaaacgacctagataaagctaacaaagacaaagccaacagattattctctccaaacttc
aaagtgaagctatttttcaccaagactgtagaagaatcttcaaactccgaagcgagcagc
tcaacttctgtaacgccggatgttagtgacaatgaacctgatcattatcgatattccgac
accactgactctgatccagagaatgaaccttttgatgaagatcagatcacacaaattaca
aaagtctga

DBGET integrated database retrieval system