KEGG   Xenopus laevis (African clawed frog): 101027271
Entry
101027271         CDS       T01010                                 

Gene name
gadd45b.S
Definition
(RefSeq) growth arrest and DNA damage inducible beta S homeolog
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101027271 (gadd45b.S)
   04068 FoxO signaling pathway
    101027271 (gadd45b.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101027271 (gadd45b.S)
   04210 Apoptosis
    101027271 (gadd45b.S)
   04115 p53 signaling pathway
    101027271 (gadd45b.S)
   04218 Cellular senescence
    101027271 (gadd45b.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    101027271 (gadd45b.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101027271 (gadd45b.S)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101027271 (gadd45b.S)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101027271
NCBI-ProteinID: NP_001267556
Xenbase: XB-GENE-17341506
UniProt: G3LSH4
LinkDB
Position
1S
AA seq 161 aa
MTFKDTTTCDNQKRRMQPVSQALEEVLVAAQKRDSLTVGVYESAKLMNVDPDRVVMCLLA
ADPEHEDNIALKIHFTLIKAFCCDNDINIVQVSGLQRLSEIIDGHSQGNPEPSDLHCILV
LDSITDSWKCSSWHQISNYCSEYRSRSQWVPLISLTERRLG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacttttaaggacaccaccacctgtgacaatcaaaagagaaggatgcagccagtgagc
caggctctggaggaggtattggtggctgcccagaagcgtgattcactgacagttggggtt
tatgaatctgcaaagctgatgaatgtagatccagacagggtggttatgtgcctgcttgct
gccgaccctgaacacgaagacaacattgctttaaaaatccacttcactttaataaaagcc
ttctgctgtgacaacgacattaatattgtgcaagtgtctggtctgcagcgtctgtcggaa
attattgatggccattcacaaggaaatcctgagcctagtgacctccactgcattctggtt
ttggattcgatcacagattcatggaagtgctcaagctggcatcaaatctccaattactgt
tcagaatacaggagcaggagtcagtgggtgcccttaatttctttgacagaacggcgattg
ggataa

KEGG   Xenopus laevis (African clawed frog): 108712402
Entry
108712402         CDS       T01010                                 

Gene name
gadd45b.L
Definition
(RefSeq) growth arrest and DNA damage inducible beta L homeolog
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108712402 (gadd45b.L)
   04068 FoxO signaling pathway
    108712402 (gadd45b.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108712402 (gadd45b.L)
   04210 Apoptosis
    108712402 (gadd45b.L)
   04115 p53 signaling pathway
    108712402 (gadd45b.L)
   04218 Cellular senescence
    108712402 (gadd45b.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108712402 (gadd45b.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108712402 (gadd45b.L)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108712402 (gadd45b.L)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 108712402
NCBI-ProteinID: XP_018110112
Xenbase: XB-GENE-6487548
LinkDB
Position
1L
AA seq 200 aa
MRGMCEAVRIEQAVGAVGALGMRDYCDSGRLLNSQYKSCCNTMTFEEIASCDNQKRKMQP
VSRALEEVLVAAQKRDSLTVGVYESAKLMNVDPDRVVLCLLASDPEHEDNVALKIHFTLI
KAFCCDNDINIVQVSGLQRLSEIIDGHSEANSEPSDLHCILVLDSITDSWKCSSWHQISN
YCSEYRSRSQWVPFVSLTER
NT seq 603 nt   +upstreamnt  +downstreamnt
atgagaggcatgtgtgaggcagtgagaattgaacaggctgtgggagcagtaggagctcta
ggaatgcgggattactgtgattctggaagattattgaactcacagtacaagagttgctgc
aacactatgacttttgaggaaatcgcctcctgtgacaatcaaaagagaaagatgcagcca
gtgagccgggctctggaggaggtgttggtggctgcccagaagcgtgattcactgacagtt
ggggtttatgaatctgcaaagctgatgaatgtagatccggacagggtggtactgtgcctg
cttgcctcagaccccgaacatgaagacaatgttgctttaaaaatccacttcactttaata
aaagccttctgctgtgacaatgacattaatattgtgcaagtgtctggtctgcagcgtctg
tcagaaatcattgatggccattcagaagcaaactctgagcctagtgacctccactgcatt
ctggttttggattcaatcacagattcatggaaatgctcaagctggcatcaaatctctaat
tactgttcagaatacaggagcaggagtcagtgggtgccctttgtttccttgacagaacgg
tga

KEGG   Xenopus laevis (African clawed frog): 108714209
Entry
108714209         CDS       T01010                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108714209
   04068 FoxO signaling pathway
    108714209
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108714209
   04210 Apoptosis
    108714209
   04115 p53 signaling pathway
    108714209
   04218 Cellular senescence
    108714209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108714209
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108714209
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108714209
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 108714209
NCBI-ProteinID: XP_018113694
UniProt: A0A1L8GLR9
LinkDB
Position
4L
AA seq 157 aa
MTLEDQLSADQTIGKMESVGNALEEVLRTAKLQRTITIGVYEAAKLLNVDPDNVVLCLLA
TDDKDGQDVALQIHFTLIQAFCCENDINILRVSNMSRLAEILGGSEKPGEPADLHCILIN
YPHELQIKDPALKEVICYCKESRYLDQWVPVINLPER
NT seq 474 nt   +upstreamnt  +downstreamnt
atgactctggaggatcaactgtctgcggatcagaccattggaaagatggagtcggtggga
aacgcgttggaggaggtgctccgcacggccaaactgcagaggaccatcaccattggggtg
tatgaggctgcaaaacttcttaatgtggacccagacaatgttgtgctttgtctgttggct
actgacgataaagacggtcaggatgtcgctttacagatccacttcaccctgatccaggca
ttttgctgtgagaatgacattaacatcctgagagtgagcaacatgagtcggttggccgag
atcctgggcggctctgaaaagccaggggaacctgctgatctgcattgtattctaatcaac
tacccacatgaattacagatcaaggatcctgctctcaaagaagtgatttgttattgcaaa
gagagtcgttatctggaccagtgggtgcctgtgattaacctgccagaacgatga

KEGG   Xenopus laevis (African clawed frog): 379224
Entry
379224            CDS       T01010                                 

Gene name
gadd45a.L, comp35, gadd, gadd45a
Definition
(RefSeq) growth arrest and DNA damage inducible alpha L homeolog
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    379224 (gadd45a.L)
   04068 FoxO signaling pathway
    379224 (gadd45a.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379224 (gadd45a.L)
   04210 Apoptosis
    379224 (gadd45a.L)
   04115 p53 signaling pathway
    379224 (gadd45a.L)
   04218 Cellular senescence
    379224 (gadd45a.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    379224 (gadd45a.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     379224 (gadd45a.L)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     379224 (gadd45a.L)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 379224
NCBI-ProteinID: NP_001079537
Xenbase: XB-GENE-864848
UniProt: Q7ZXZ4
LinkDB
Position
4S
AA seq 157 aa
MTLEEQLSGDQSIGKMESVGNALEEVLHEAKLQRTITIGVYEAAKLLNVDPDNVVLCLLA
TDDKDNQDVALQIHFTLIQAFCCENDINILRVSNMSRLAEILGGSDKPGEPADLHCILIN
NPHELQIKDPALKEVICYCKESRYLDQWVPVINLPER
NT seq 474 nt   +upstreamnt  +downstreamnt
atgactctggaggagcagctgtctggggatcagagcattggaaagatggaatccgtggga
aatgcattggaggaagtactccatgaagccaaactgcagaggaccatcaccattggggtg
tacgaggctgcaaaactccttaatgtggacccagacaatgttgtgctttgtctgttggct
actgatgataaagacaatcaggatgtcgctttacagattcatttcaccctgatccaggca
ttttgctgtgagaatgacatcaacatcctgagagtgagcaacatgagtcggctggccgag
atcctgggcggctctgacaagccaggggaacctgctgatctgcattgtattctaatcaac
aacccacatgaattacagatcaaggatcctgctctcaaagaagtgatttgttactgcaaa
gaaagtcgttatctggaccaatgggtgcctgtgattaacctgccagagcgatga

KEGG   Xenopus laevis (African clawed frog): 379285
Entry
379285            CDS       T01010                                 

Gene name
gadd45g.S, xgadd45g
Definition
(RefSeq) growth arrest and DNA damage inducible gamma S homeolog
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    379285 (gadd45g.S)
   04068 FoxO signaling pathway
    379285 (gadd45g.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379285 (gadd45g.S)
   04210 Apoptosis
    379285 (gadd45g.S)
   04115 p53 signaling pathway
    379285 (gadd45g.S)
   04218 Cellular senescence
    379285 (gadd45g.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    379285 (gadd45g.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     379285 (gadd45g.S)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     379285 (gadd45g.S)
SSDB
Motif
Pfam: Ribosomal_L7Ae DUF1697
Other DBs
NCBI-GeneID: 379285
NCBI-ProteinID: NP_001079598
Xenbase: XB-GENE-17331725
UniProt: Q7ZXC4
LinkDB
Position
1S
AA seq 159 aa
MTLEEVHGQETVVESADRMQSAGKALHELLVSAQRQECLTVGVYESAKVMNVDPDSVTFC
ILAADEYDEGDIALQIHFTLIQAFCCENDINIVRLNDTEKVAQILGFTDESAEPKDLHCI
LITNPNEDAWKDPALEKLAVFCEESRKVYDWVPTIALPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcacggacaagaaaccgttgttgaaagcgctgacaggatgcaa
agcgccggcaaagccctgcatgaactgctcgtctctgcccagagacaggagtgtctgacc
gttggagtctatgagtctgccaaagtcatgaatgtagatccagatagcgtcactttctgc
attttggctgctgacgaatacgatgagggagacatagcccttcagatccacttcactctg
attcaggctttctgctgcgaaaatgacatcaatatagtgaggctgaacgacaccgaaaaa
gtcgctcaaattctaggcttcactgatgagtctgcagagcccaaggaccttcactgcatt
cttattacgaatccaaatgaggatgcctggaaagatccagctctggagaaacttgctgta
ttctgcgaggaaagccgtaaagtctatgactgggttcccactattgccctgcccgagtga

KEGG   Xenopus laevis (African clawed frog): 399196
Entry
399196            CDS       T01010                                 

Gene name
gadd45g.L, gadd45g, xgadd45-gamma, xgadd45g
Definition
(RefSeq) growth arrest and DNA damage inducible gamma L homeolog
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    399196 (gadd45g.L)
   04068 FoxO signaling pathway
    399196 (gadd45g.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    399196 (gadd45g.L)
   04210 Apoptosis
    399196 (gadd45g.L)
   04115 p53 signaling pathway
    399196 (gadd45g.L)
   04218 Cellular senescence
    399196 (gadd45g.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    399196 (gadd45g.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     399196 (gadd45g.L)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     399196 (gadd45g.L)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 399196
NCBI-ProteinID: NP_001083928
Xenbase: XB-GENE-864811
UniProt: Q8UUP4
LinkDB
Position
1L
AA seq 159 aa
MTLEEVHGQETVVESTDRMQSAGKSLHELLVSAQRQECLTVGVYESAKVMNVDPDSVTFC
ILAADEYDEGDIALQIHFTLIQAFCCENDIDIVRLNDTEKVAQILGLTDESAEPKDLHCI
LITNPNEDAWKDPALEKLAIFCEESRKVYDWVPTITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcacggacaagaaaccgttgttgaaagcactgacagaatgcaa
agtgctggcaaatccctgcatgagctactggtctctgcccagagacaggaatgtctgacc
gttggagtctatgagtctgccaaagtcatgaatgtagatccagacagtgttacattctgc
attttggctgctgatgaatacgacgaaggtgatatagcccttcagatccacttcactctg
attcaagctttctgctgtgaaaatgacatcgatatcgtgaggctgaacgacacagaaaaa
gtcgctcaaatactaggcttaactgatgagtctgcagaacccaaggacctgcactgcatc
cttattacgaatccaaatgaggatgcatggaaagatccagctctggagaaacttgctata
ttctgcgaggaaagccgcaaagtctatgactgggttcccactatcaccctgcccgagtga

DBGET integrated database retrieval system