KEGG   Xenopus laevis (African clawed frog): 108695333
Entry
108695333         CDS       T01010                                 

Gene name
klf2.L, lklf
Definition
(RefSeq) Kruppel-like factor 2 L homeolog
  KO
K17845  krueppel-like factor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108695333 (klf2.L)
   04068 FoxO signaling pathway
    108695333 (klf2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108695333 (klf2.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    108695333 (klf2.L)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5
Other DBs
NCBI-GeneID: 108695333
NCBI-ProteinID: XP_018079276
Xenbase: XB-GENE-17341927
LinkDB
Position
1L
AA seq 369 aa
LPAVVTFFYLFYLQRWKCDYESKSPHGSCGIPDVLQSPDPFSSKKEDEDLNSVLEFVLSM
GGDKIVQTCGEYQMASSESCTYYQTSPSRGSFSTDQSPPPYSSGSLMTELIRSDMDNYCH
PSSVQGRFFVTSNFDFPDTIKAEPDMDSYGPVVGMVPQSCTKIKQEGSTACMMAYEQPRL
ANSPQMGGPDTPPLSPDDIMLSECQSQLMCHPSLPYAHNYQHAGFHHQSPVQYQNTSQYG
MFEENLPMQPSIARGMITPPCSPLEILDTKPKRGRRSWPRKRTATHTCSYAGCGKTYTKS
SHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCDRAFSRSDH
LALHMKRHM
NT seq 1110 nt   +upstreamnt  +downstreamnt
ctacctgcggtcgtgacgttcttttatcttttctatttgcagaggtggaagtgtgactat
gagtccaagtctccccacggcagctgtggcattccagatgttttacaaagtccagacccc
ttctcctctaagaaggaagacgaagacttaaacagtgttctggaattcgtgttgtccatg
ggtggtgacaaaattgtccaaacctgtggagagtatcaaatggcatcttcagagtcctgc
acttactaccaaacaagcccttctcggggaagcttcagcacagaccaaagccctcctcct
tacagttcaggtagcctcatgactgaactgattagatctgacatggacaactactgccac
cccagcagtgttcaagggaggttctttgtgacatcaaattttgactttccagatacaatc
aaagcagaacctgacatggattcatatggaccagttgtgggcatggttccccagtcatgc
acaaagatcaagcaagaaggcagtaccgcttgtatgatggcatatgaacagcctagactt
gccaattctcctcagatgggtggccctgacacccctcctttgagccctgatgacataatg
ttaagtgaatgccagtcccagttgatgtgccatccttcactgccttatgctcataattat
cagcatgctggcttccatcaccagtcacctgtccagtatcaaaatacctcccagtatggc
atgtttgaggaaaatctgcccatgcagccttctattgccaggggcatgataacgcctcct
tgttcccctttggaaatactggataccaagccaaagagaggccgcagatcttggcccagg
aaaaggacagcgacacacacttgctcttatgctggttgcgggaagacttacacaaagagt
tcccacttgaaagctcatctccgaacacacacaggcgagaaaccttatcactgcaactgg
gaaggatgcggctggaaatttgcccgatctgatgaactgactcgccacttccgcaagcat
actggccaccggcccttccagtgccatctgtgtgaccgtgctttctctcgatccgaccac
cttgcactgcacatgaagaggcacatgtag

KEGG   Xenopus laevis (African clawed frog): 380122
Entry
380122            CDS       T01010                                 

Gene name
klf2.S, klf2, lklf
Definition
(RefSeq) Kruppel-like factor 2 S homeolog
  KO
K17845  krueppel-like factor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    380122 (klf2.S)
   04068 FoxO signaling pathway
    380122 (klf2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    380122 (klf2.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    380122 (klf2.S)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Phage_BR0599 zf-H2C2_5
Other DBs
NCBI-GeneID: 380122
NCBI-ProteinID: NP_001080430
Xenbase: XB-GENE-485039
UniProt: Q8QGW5
LinkDB
Position
Un
AA seq 373 aa
MALSETILPSFATFASQDRWKCEYESKSPRGSCGIPDVMQSPDPFSSRKEDEDLNNVLEF
VLAMGCDKSLQTCGDFSMAPSESCTYYQTSPSQGSYSTDQSPPPYSSGSLMTELIRSDMD
NYCHPSNVQGRFFVSSNFDFPDTIKAEPDMDSYGPVMGMVPQSCTKIKQEGSTACMMAYE
QPRLANSPQMGGPDTPPLSPDDIMLSECQSQLMCHPSLPYAPNYPHAGFHHQSPIQYQNT
SQYGMFEDNMPMQPSIARGMITPPCSPLEILETKPKRGRRSWPRKRTASHTCSYAGCGKT
YTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCDRAFS
RSDHLALHMKRHM
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctctgagcgagaccattctcccttctttcgctacgtttgcaagccaagataggtgg
aagtgtgagtatgagtccaagtctccccgcggcagctgtggcattccagatgtaatgcaa
agcccagaccccttctcttctaggaaggaagacgaagatttaaacaatgttctggaattt
gtgttggccatgggctgtgacaaaagtctccaaacctgtggagacttttcaatggcacct
tccgagtcctgcacttactaccaaacaagcccttctcagggaagctacagcacagaccaa
agccctcctccttatagttcgggtagcctcatgactgaacttattaggtctgacatggac
aactactgccatcctagcaatgttcaagggagattctttgtgtcatcaaattttgacttt
ccagatacaatcaaagcagaacctgacatggattcatatggaccagttatgggtatggtt
ccccagtcctgcacaaagatcaagcaagagggcagtactgcttgtatgatggcatatgaa
cagcctagacttgctaattctcctcagatgggtggccctgacacccctcctttgagcccc
gatgacataatgttaagtgaatgccagtcccagttgatgtgccacccttcactgccttat
gctcctaattatccgcatgctggcttccatcaccagtcacctatccagtatcaaaatacc
tcccagtatggcatgtttgaggacaatatgcccatgcaaccttctattgccaggggcatg
ataacacctccctgctcccctttggaaatattggaaaccaagccaaagagaggccgcaga
tcttggcctaggaaaaggacggcgtcacacacttgctcttatgctggttgtgggaagacc
tacacaaagagttcccacttgaaagcccatctcagaacccacacaggtgagaagccttat
cactgcaactgggaaggatgtggctggaaatttgcccgatctgatgaactaacgcgccat
ttccgtaagcatactggccaccggcccttccagtgccatctgtgtgaccgtgccttctct
cgatctgaccaccttgcactgcacatgaagaggcacatgtag

DBGET integrated database retrieval system