KEGG   Xenopus laevis (African clawed frog): 108695369
Entry
108695369         CDS       T01010                                 

Gene name
e2f5.S
Definition
(RefSeq) E2F transcription factor 5, p130-binding S homeolog
  KO
K04682  transcription factor E2F4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108695369 (e2f5.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108695369 (e2f5.S)
   04218 Cellular senescence
    108695369 (e2f5.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108695369 (e2f5.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108695369 (e2f5.S)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP SKA2 Rx_N
Other DBs
NCBI-GeneID: 108695369
NCBI-ProteinID: XP_018079322
Xenbase: XB-GENE-17331901
UniProt: A0A1L8FTC0
LinkDB
Position
6S
AA seq 371 aa
MAEAAGASSRHEKSLGLLTSKFVSLLQEAKDGVLDLKVAADSLAVRQKRRIYDITNVLEG
IGLIEKKSKNSIQWNGVGAGCNTKEVLDRLRNLKAEIEDLELKEKELDQQKAWLQQSIKN
VMDSSENGMYSFVTHEDLCNCFNGDTLLAIQAPSGTQLEVPVPEMGQNGQKKYQISLKSN
SGPIQVLLINKESSSSKPVVFPVPPPDDLTQPNSQPEATSSSNKQPAAQNSSLSAKQQQE
SDLAEQAAAGKLNPDCTASDLQENTSSSYPELPESILYSAHGTDVAQSAAASSDYSPLLP
LDVNSILRPNAFDITKIDEQEGHISGDLIDELMSSDVFPLLRLSPTPDDYNFNLDDNEGV
CDLFDVQILNY
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcggaagcagcgggagcgtccagccggcacgagaagagccttgggctgctcactagt
aagtttgtgtcgctgctgcaggaggcgaaggatggggtgctcgacctgaaagtggctgca
gatagtcttgctgtcagacaaaaaagaagaatatatgatattaccaatgttttggaaggt
attggtttaatagagaagaagtccaagaacagcattcagtggaatggtgtaggtgcaggt
tgcaacacaaaagaagtgcttgaccgactaaggaatctgaaagcagaaattgaggaccta
gaacttaaggagaaagaactggaccagcaaaaagcatggcttcagcaaagcatcaagaat
gtaatggattcatctgaaaatggaatgtattcatttgttacacatgaagacctgtgtaac
tgctttaatggagacactcttcttgctatccaggctccatctggcactcaattggaagtt
ccagttcctgaaatgggtcaaaacggacaaaagaaataccagattagtttaaagagtaat
tcaggtcctattcaggtacttctaattaataaggaatccagttcctccaagccagtcgtc
tttcctgttcctccaccggatgaccttacacaacccaattcacagcctgaagctacatcc
tcttcaaataaacagccggcagcacagaatagctctctcagtgcaaaacaacaacaagag
agcgacctggcggaacaggcagctgcaggtaaattaaaccctgattgcacagccagtgat
ctacaggagaacacgtccagctcttaccctgaacttcctgagtcaattctgtattctgca
catgggacagatgtagcacaaagcgcagctgcttcaagtgactattctcctctgcttcca
ttggatgttaatagtattctgagacccaatgcattcgatataacaaaaattgatgagcag
gaaggtcacataagtggagaccttattgatgagcttatgtcttctgatgttttcccattg
ttacgactttcaccaactccagatgactacaacttcaatttggatgacaatgaaggcgtc
tgtgatctctttgatgtgcagatattaaattattag

KEGG   Xenopus laevis (African clawed frog): 108714169
Entry
108714169         CDS       T01010                                 

Gene name
e2f4.L
Definition
(RefSeq) E2F transcription factor 4, p107/p130-binding L homeolog
  KO
K04682  transcription factor E2F4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108714169 (e2f4.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108714169 (e2f4.L)
   04218 Cellular senescence
    108714169 (e2f4.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108714169 (e2f4.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108714169 (e2f4.L)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP DivIC
Other DBs
NCBI-GeneID: 108714169
NCBI-ProteinID: XP_018113621
Xenbase: XB-GENE-17341138
UniProt: A0A1L8GLJ2
LinkDB
Position
4L
AA seq 374 aa
MADPAQLPVTPSRHEKSLGLLTSKFVSLLQEAEDGVLDLKAAADTLAVRQKRRIYDITNV
LEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIDLKAELADLEQREQELDQQRVWVQQS
IKNVTDDVHNNGLAYLTHEDICHCFRGDTLLAIRAPSGTCLEVPVPENTNGQKKFQIHLK
STTGPIEVLLVNKDTSSSPPVVVPVPPPEDLIQTPPAVPSTPQRPALTPQNDTATSQAPA
IPHSPISNAESQDCPADQTLSMENTTSSRLASIDTCPLQSSASLDNSTDLPDPSTSFQPI
KSDLSDVLELPKDISDFFDQTKECITSDLLEELMSSEVFAPLLRLSPPPGDHDYVYNLDE
SEGVCDLFDVPINL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcggatcccgctcagctcccagtcacaccgagccggcacgaaaaaagcctcggactg
ctcaccagcaagttcgtttctcttttgcaagaggccgaggacggggttttggacctcaag
gcggcagcagacactttagctgtgagacaaaaacgcagaatctatgacatcactaatgtt
ttagaaggaattggattgattgagaagaaatcaaagaacagtattcagtggaagggtgta
ggccctgggtgtaatacacgggagattgctgacaaacttattgacctgaaggcagaactt
gctgaccttgagcagcgggaacaggaactggatcagcagcgtgtatgggtgcagcagagc
ataaaaaacgtcaccgatgatgtgcataataatgggctagcatatcttacccatgaggat
atatgtcactgttttagaggtgacaccttacttgcaattagagcaccatcgggcacatgt
ttagaagtgccagttccagagaataccaacggacagaagaagtttcagatacacttaaaa
agtacaactgggccaatagaagtacttttagttaacaaagatacatcaagctctcctcca
gttgttgtccctgttccacctccagaagacctcatccagactcctcctgcagtacccagt
acacctcagaggccagcattgactccacaaaatgatactgctactagccaagctcctgct
ataccccacagtcctatttcaaatgcagagtcacaagattgtccagctgaccaaactcta
agtatggaaaacacaacctcctctcgtcttgcaagtatagatacatgcccccttcagtct
tcagcctccttggacaacagtaccgacttaccagatccctctacctcattccagccaata
aaatcagatctctcagatgtactggaattgccaaaagatatatctgatttttttgatcaa
acaaaagaatgtatcacttcagacttgttagaagaattaatgtcctctgaagtttttgct
cctctgctcagactctctcctcctcctggtgaccatgactatgtctataatttggatgaa
agtgaaggagtttgcgatctttttgatgtacccatcaatctctga

KEGG   Xenopus laevis (African clawed frog): 108719317
Entry
108719317         CDS       T01010                                 

Gene name
e2f5.L
Definition
(RefSeq) E2F transcription factor 5, p130-binding L homeolog
  KO
K04682  transcription factor E2F4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108719317 (e2f5.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108719317 (e2f5.L)
   04218 Cellular senescence
    108719317 (e2f5.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108719317 (e2f5.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108719317 (e2f5.L)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP SKA2 Rx_N
Other DBs
NCBI-GeneID: 108719317
NCBI-ProteinID: XP_018123589
Xenbase: XB-GENE-6486363
UniProt: A0A1L8FZF3
LinkDB
Position
6L
AA seq 371 aa
MAEPAGASSRHEKSLGLLTSKFVSLLQEAKDGVLDLKVAADSLAVRQKRRIYDITNVLEG
IGLIEKKSKNSIQWNGVGAGCNTKEVLDRLRHLKAEIEDLELKERELDQQKAWLQQSIKN
VMDSSSNGIYSFVTHEDLCNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQISLKSN
SGPIQVLLINKESSSSKPVVFPVPPPDDLTQPNSQPEATASSNKQPAAQNSSLCAKEEHE
SNLTEQAAAGKLKPECAASDLQENTSSSYPELPESILYSALGTDVAHSTAGSSGYSPLLP
LDVNCILRPNAFDITKMDEQEGQISGDLIDELMSSDVFPLLRLSPTPDDYSFNLDDSEGV
CDLFDVQILNY
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcggaaccagcgggagcgtccagccggcacgagaagagccttgggcttctcactagt
aaatttgtgtcgctgctacaggaagcgaaggatggagtgctcgacctgaaagtggctgca
gatagtcttgctgtcagacaaaagagaagaatatatgatattaccaatgttttggaaggt
attggtttaatagagaagaagtcaaagaacagcattcagtggaatggtgtaggtgcaggt
tgcaacaccaaagaagtgctcgacagactaaggcacctgaaagcagaaattgaggacctg
gaactaaaggagagagaactggaccagcaaaaagcatggctgcagcaaagcatcaaaaat
gttatggattcatcctccaatggaatatattcatttgttactcacgaagacctgtgtaac
tgctttaatggagacactctccttgctatccaggctccatctggcactcaactggaagtt
ccaattcccgaaatgggtcaaaatggacaaaagaaataccagattagtttaaagagtaat
tcaggtccaattcaggtacttttgataaataaggaatccagctcatccaagccagtcgtc
tttcctgttcctccaccggatgaccttacacaacccaattcacagcctgaagcaacggcc
tcttcaaataaacagccagcagcacagaatagctctctctgtgcaaaagaagaacatgaa
agcaacctgacagaacaggcagctgcaggtaaattaaaacctgagtgcgcagccagcgat
ctacaggagaacacgtcaagctcttaccctgaacttcctgagtccattctgtattctgcg
cttgggacagacgtagcacacagcacagccggttccagtggctattcccctttgcttccg
ttggatgttaattgtattttaagacccaatgcatttgacataacaaaaatggacgagcag
gaaggtcaaattagcggagaccttattgatgagcttatgtcttctgatgttttcccattg
ttacggctttcaccaactccagatgactacagcttcaatttggatgacagtgaaggagtc
tgtgatctctttgatgtgcagatattaaattattag

KEGG   Xenopus laevis (African clawed frog): 446541
Entry
446541            CDS       T01010                                 

Gene name
e2f4.S, E2F-4, e2f4
Definition
(RefSeq) E2F transcription factor 4, p107/p130-binding S homeolog
  KO
K04682  transcription factor E2F4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    446541 (e2f4.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    446541 (e2f4.S)
   04218 Cellular senescence
    446541 (e2f4.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    446541 (e2f4.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    446541 (e2f4.S)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP DivIC
Other DBs
NCBI-GeneID: 446541
NCBI-ProteinID: NP_001086706
Xenbase: XB-GENE-482725
UniProt: Q6DE14 A0A1L8GEZ4
LinkDB
Position
4S
AA seq 375 aa
MADPAQLTVTPSRHEKSLGLLTSKFVSLLQEAEDGVLDLKAAADTLAVRQKRRIYDITNV
LEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIDLKAELADLEQREQELDQQRVWVQQS
IKNVTDDVQNTGLAYLNHEDICRCFRGDTLLAIRAPSGTCLEVPVPENTNGQKKFQIHLK
STTGPIEVLLVNKDTSSSAPVVVPVPPPEDLIQAPPAVPSTPQRPALTPQNDIATSPAPT
VPHSTISNAESQDCPTGQTFSMENTTSSRLPSIDTCPLQSSASLDNSNDSPDPSTSFQPI
KSDLSDVLELPKDMISDFFDQTKECITSDLLEELMSSEVFAPLLRLSPPPGDHDYVYNLD
ESEGVCDLFDVPINL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcggatcccgctcagctcacggtcactccaagccggcacgagaaaagcctcgggctc
ctcaccagcaagttcgtttctcttttgcaagaggccgaggacggggttttggacctcaag
gcggcagcagacactttagctgtgagacaaaaacgcagaatctatgacatcactaatgtt
ttagaaggaattggattgattgaaaagaaatcaaagaacagtattcagtggaagggggta
ggccctggctgtaatacacgggagattgctgacaaacttatcgacctgaaggcagaactt
gctgaccttgagcagcgggaacaggaactggaccagcagcgtgtgtgggttcagcagagc
ataaaaaatgtcacagatgatgtgcagaatactgggctagcatatcttaaccatgaagat
atatgccgctgttttagaggagacaccttacttgcaattagagcaccatcaggcacatgt
ttagaagtgccagttccagaaaataccaatggacagaagaaatttcagattcacttaaaa
agtacaactgggccaatagaagtacttttagtcaacaaagatacatcaagctctgctcca
gttgtcgtccctgttccacctccagaagacctcatccaagcacctcctgcagtacccagt
acaccccagaggccagcattgactccacaaaatgatattgctactagtccagcccctact
gtgccccacagtactatatcaaatgcagagtcacaagattgcccaactggccaaactttc
agtatggaaaacacaacttcctctcgtcttccaagtatagatacatgtccccttcagtct
tcagcctccttggacaacagtaacgactcaccagatccctctacctcattccagccaata
aaatcagatctctcagatgtactggaattgcctaaagatatgatttctgatttttttgat
caaacaaaggaatgtatcacttcagacttactggaagaattaatgtcctcagaagttttt
gctcctctgctcagactctcccctcctcccggtgatcacgactatgtctataatttagat
gaaagtgaaggagtttgtgatctcttcgatgtacccatcaacctctga

DBGET integrated database retrieval system