KEGG   Xenopus laevis (African clawed frog): 108695407
Entry
108695407         CDS       T01010                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla00480  Glutathione metabolism
xla00983  Drug metabolism - other enzymes
xla01100  Metabolic pathways
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108695407
   00240 Pyrimidine metabolism
    108695407
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108695407
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108695407
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108695407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    108695407
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     108695407
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    108695407
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 108695407
NCBI-ProteinID: XP_018079383
UniProt: A0A1L8FTL6
LinkDB
Position
6S
AA seq 346 aa
MGDPGLPSDTGRTQDKNLTNGCSDEQEPFLRKNPQRFVIFPIHYPDIWKMYKKAQASFWT
AEEVDLSKDLAHWEKLKSEEKNFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYG
FQILIENVHSEMYSLLIETYIKDPHRREFLFNAIETMPCIRKKAEWALRWISDRKASFGE
RVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVNK
PTEERVAEIIVNAVRIEQEFLTEALPVSLIGMNCTLMKTYIEFVADRLLVELGFSKVFKA
ENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAHTEDNVFTLDADF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgggggatccggggcttcctagtgacacaggccggactcaggacaagaatctaaccaat
ggctgcagcgatgagcaggagccttttctcaggaaaaacccccaaagatttgtcatcttc
ccaatccattacccggatatctggaaaatgtataagaaggcccaagcctcattctggacc
gcggaggaagtcgacttatccaaagatcttgcgcactgggaaaagctaaagtcggaggag
aaaaactttatttcgcacattctggccttcttcgctgctagtgatggaatagtgaatgag
aatctggtggagcgattcagtcaggaggtgcaagtcccagaagctcgctgcttttatggc
ttccagattctcatagagaacgttcattctgagatgtacagcctgctcatagagacctac
ataaaagatccccacagacgagagtttttattcaatgccatagaaacgatgccgtgtata
aggaagaaagcagagtgggcactaaggtggatatctgatcgaaaagcttcctttggagaa
agagtcgtggcatttgctgcagtagaaggaatattcttctctgggtcctttgctgcaatt
ttctggctaaagaaaaggggtctcatgcctggactcaccttttccaacgagctgatcagt
agagatgagggtctccactgtgactttgcctgcctgatgttccattacttggttaacaag
cctacagaagagagggtcgctgaaattatcgttaatgccgtcagaattgagcaggagttc
ttgacggaagccttgccagtgagtctcattggaatgaactgtacattaatgaagacttac
atagagttcgtagctgatcgtctccttgtagaacttgggttttcaaaggtgtttaaagca
gaaaacccctttgattttatggagaacatttctctggaagggaaaaccaatttctttgag
aagcgggtgtcagagtaccagcgttttgctgtcatggcgcacacagaagacaacgtcttt
acactggatgcagatttctga

KEGG   Xenopus laevis (African clawed frog): 379056
Entry
379056            CDS       T01010                                 

Gene name
rrm2b.S, p53r2, rrm2b
Definition
(RefSeq) ribonucleotide reductase M2 B (TP53 inducible) S homeolog
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla00480  Glutathione metabolism
xla00983  Drug metabolism - other enzymes
xla01100  Metabolic pathways
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    379056 (rrm2b.S)
   00240 Pyrimidine metabolism
    379056 (rrm2b.S)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    379056 (rrm2b.S)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    379056 (rrm2b.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    379056 (rrm2b.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    379056 (rrm2b.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     379056 (rrm2b.S)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    379056 (rrm2b.S)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 379056
NCBI-ProteinID: NP_001079369
Xenbase: XB-GENE-6251831
UniProt: Q8AVY2
LinkDB
Position
5S
AA seq 386 aa
MLSARKPFAELNENVSPMKNLTLTEKENTPSTLNSSRVLASKTARKIFHETETPKSKAPK
NPRLEDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKKEE
KYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIHSEMYSLLIDTY
VKDPKEREYLFNAIETLPCVKKKADWALHWIGDKQATFGERVVAFAAVEGIFFSGSFASI
FWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIRKPSEERVVELITDAVQIEQEF
LTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFKKVFKATNPFDFMENISLEGKTNFFE
KKVGEYQKMGVMSKAKDNTFTLDADF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgttgtctgcccgtaagcctttcgctgagcttaacgagaacgtgtctcccatgaagaac
ctgaccctgacagaaaaagagaatacgccgtcaacccttaacagcagccgcgtcctggcc
agcaagaccgcccgaaagatcttccacgagaccgaaacgcctaagtctaaagccccaaaa
aatcctagacttgaagatgaaccacttttgaaggataatccacatagatttgtgatcttc
cccatccaatatcatgacatctggcaaatgtacaagaaagcagaagcttcattctggact
gctgaggaggtggatctgtctaaggaccttcagcactgggagtcccttaagaaagaagaa
aaatactttatatctcatgtgttggccttttttgcagccagcgatggcatagtaaacgaa
aacctggtggagaggtttagcaaagaagtgcaagttacagaggctcgctgcttttatggc
ttccaaattgcaatggagaatattcattcagaaatgtacagccttcttattgacacctac
gttaaagatcccaaggagagggaataccttttcaatgctattgagacactgccttgtgtg
aaaaagaaggctgactgggctctgcactggattggtgacaaacaagcaacctttggtgaa
cgagttgttgcatttgcagctgttgaaggtatcttcttctctggctcatttgcatccatt
ttttggctgaagaaacgggggctgatgcctggactcactttctctaatgaacttattagc
agagatgaaggtttacattgtgactttgcctgccttatgttcaaacatcttatacgcaaa
ccttcagaagagcgtgttgttgagcttattactgatgctgttcaaattgaacaggaattc
ttaactgaagctttgcctgtaaatctcattggcatgaactgtactttaatgaagcagtac
attgaatttgttgcagatcgtcttctcctagagcttggctttaaaaaggtttttaaggcc
acaaatccatttgacttcatggaaaacatctcattggaaggaaagactaacttttttgag
aagaaagttggagaataccagaagatgggtgttatgtccaaggcaaaagacaacactttt
acactggatgctgacttctaa

KEGG   Xenopus laevis (African clawed frog): 380465
Entry
380465            CDS       T01010                                 

Gene name
rrm2.2.L, rrm2, rrm2.2
Definition
(RefSeq) ribonucleotide reductase M2, gene 2 L homeolog
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla00480  Glutathione metabolism
xla00983  Drug metabolism - other enzymes
xla01100  Metabolic pathways
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    380465 (rrm2.2.L)
   00240 Pyrimidine metabolism
    380465 (rrm2.2.L)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    380465 (rrm2.2.L)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    380465 (rrm2.2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    380465 (rrm2.2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    380465 (rrm2.2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     380465 (rrm2.2.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    380465 (rrm2.2.L)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 380465
NCBI-ProteinID: NP_001080772
Xenbase: XB-GENE-486929
UniProt: Q801Q4
LinkDB
Position
5L
AA seq 386 aa
MLSARKPFAQLNDNVSPMKNLTLTEKENTPPTLNSTRVLASKTARKIFQEADTPTSKVPK
NPRFTDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKTDE
RYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIHSEMYSLLIDTY
IKDPKERGFLFNAIETLPCVKKKADWALRWISDKQATYGERVVAFAAVEGIFFSGSFASI
FWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFRHLVHKPSEERVVQLITNAVQIEQEF
LTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKASNPFDFMENISLEGKTNFFE
KRVGEYQKMGVMSKPKDNTFTLDADF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgttgtctgcccgcaaacccttcgcccagcttaacgacaacgtgtctcccatgaagaac
ctgaccctgacagaaaaagagaacacgccgcctacccttaacagcacccgcgtcctggcc
agcaagaccgcccgcaagatcttccaggaggcagacacgcccacgtctaaagtcccaaag
aatcctagatttacagatgagccccttctgaaggataatccacatagatttgtgatcttc
cccatccagtatcatgacatctggcaaatgtacaagaaagcagaagcttcattctggact
gctgaagaggtggatctgtctaaggacattcagcactgggagtccctgaagacagacgaa
agatactttatctctcatgtgttggccttttttgcagctagtgatggcatagtaaacgag
aacctggtggagaggtttagcaaggaggtgcaagttactgaggctcgctgcttttatggc
ttccaaatcgcaatggagaacattcattctgaaatgtacagccttcttattgacacctac
attaaagatcccaaggagaggggattccttttcaatgctattgaaactttgccttgtgtg
aaaaagaaggctgattgggctctgcgctggattagtgacaaacaggcaacatatggtgaa
cgagtggtggcatttgctgctgttgaagggatcttcttctccggttcatttgcatccatt
ttttggctgaagaaacgtggactgatgcctggactcactttctctaatgaacttattagc
agagatgaaggtttacattgtgactttgcttgccttatgttcagacatcttgtacacaaa
ccttcagaagagcgtgttgttcagcttattactaatgctgttcaaattgaacaggaattc
ttaacagaagctttgcctgtaaatctcattggaatgaattgtactttaatgaagcagtat
attgaatttgttgcagaccgtcttctactggagcttggctttaataaggttttcaaggcc
tctaatccatttgacttcatggaaaacatctctttggaaggaaagactaacttctttgag
aagagagttggtgaataccagaagatgggtgtcatgtcaaagccaaaagataacactttc
acactggacgctgacttttaa

KEGG   Xenopus laevis (African clawed frog): 443815
Entry
443815            CDS       T01010                                 

Gene name
rrm2.1.L, RRM2-beta, XRRM2-beta, gast01, rr2m, rrm2.1
Definition
(RefSeq) ribonucleotide reductase M2, gene 1 L homeolog
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla00480  Glutathione metabolism
xla00983  Drug metabolism - other enzymes
xla01100  Metabolic pathways
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    443815 (rrm2.1.L)
   00240 Pyrimidine metabolism
    443815 (rrm2.1.L)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    443815 (rrm2.1.L)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    443815 (rrm2.1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    443815 (rrm2.1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    443815 (rrm2.1.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     443815 (rrm2.1.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    443815 (rrm2.1.L)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 443815
NCBI-ProteinID: NP_001085389
Xenbase: XB-GENE-947057
UniProt: Q6IP47
LinkDB
Position
5L
AA seq 406 aa
MLSPRNALSPLKENVSPMKRMVLSDKENTVGSAELLVRQTWRCTEQTLTCSSFCRFQPPN
VNSDRISRGTQKELVCQSVKDPLIQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWT
AEEVDLSKDLQHWETLKPEERYFIAYVLAFFAASDGIVNENLVERFSQEVQVTEVRCFYG
FQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWSLRWISDREAPYCE
RLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVVHK
PSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFKS
ENPFDFMENISLEGKTNFFEKKVGEYQKMGVMAKATENQFTLNADF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgttgtctcctcgcaacgcgctcagtccgctaaaggagaacgtgtctcccatgaagaga
atggtcctgtcagataaagagaacactgtaggttcagccgagctattagtcaggcaaaca
tggcggtgtacagagcagactctcacttgttcctctttctgtcgcttccagccccctaac
gtaaactccgacaggatctcccggggaacacagaaagaactggtctgtcagagcgtaaag
gatcctctgatacaggatgagcctctcctgagggacaacccaggccgctttgtgatcctg
cctattgagtatcatgacatatggcagatgtacaagaaggcagaggcttctttctggacg
gcagaagaggtggatctttctaaagatcttcagcactgggaaactttaaagcctgaagaa
agatacttcattgcttatgtgttggccttttttgcagcaagcgatgggattgttaatgag
aatctggtggagcgcttcagccaggaagtgcaagtaaccgaggttcgctgcttttatggt
tttcaaattgcaatggagaacattcattctgaaatgtacagtcttctgattgacacatat
attaaggatcccaaggaaagggagttcctcttcaatgcaatagaaaccttgccctgtgtt
aaaaagaaggcagaatggtccctgcgttggataagtgaccgagaagcaccttattgtgag
cgccttgtggcctttgctgctgttgaagggatatttttctctggttcatttgcttccata
ttctggctgaagaaacgagggctgatgcctggactcactttctctaacgaacttattagc
agagatgaaggtttgcacactgactttgcttgccttttgtttaaacatgttgtacacaaa
ccctcagagcaacgtgtcagggaaattatcattgatgcggtcaagattgagcaggaattc
ttgactgaagctctacctgtggagctaattggtatgaactgcacactgatgaagcagtat
attgaatttgtagcagatcggcttctgctggagcttggttttaaaaagatttttaagtct
gagaatccatttgacttcatggaaaacatctccttagaaggaaagaccaatttctttgag
aagaaagttggtgaataccagaagatgggtgtcatggctaaggccacagaaaaccaattc
actctaaatgctgacttttaa

DBGET integrated database retrieval system