KEGG   Xenopus laevis (African clawed frog): 108695463
Entry
108695463         CDS       T01010                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108695463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108695463
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108695463
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    108695463
Peptidases and inhibitors [BR:xla01002]
 Mixed peptidases
  Family P2
   108695463
Membrane trafficking [BR:xla04131]
 Endocytosis
  Phagocytosis
   Others
    108695463
G protein-coupled receptors [BR:xla04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   108695463
SSDB
Motif
Pfam: 7tm_2
Other DBs
NCBI-GeneID: 108695463
NCBI-ProteinID: XP_018079479
UniProt: A0A1L8FTZ9
LinkDB
Position
6S
AA seq 685 aa
MNLEKVLIPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVILINFCLSIISSNALI
LIGQTQTRNKVICTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGW
GLPALVVAISVGFTKAKGYGSANYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLV
SKDGIADKKLKERAGICDFNCSQMTMPLYGMTLKCSKCGIVSSAEVSATATSNAMASLWS
SCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCR
VVDQQEEGNGDSGGSFQNGHAQLMLEEANNPYICTAMVGLKDKKIPSDFEKDVDFACRSV
LNKDSSTLRTSTITGTLKRPSLQDEEKMKMNHQKGSNFNSLPSNASKIHHQGSPHYLGGI
NLNEFNNHTLTLKKDKSQSSKPMYMCEGDIFKKLDSELTRAQEQSMDPSYVILPSNTSTL
RAKPKEENKYSMNIDQMPQTRLIHLNMADPSYMLKSPPRERIGMQCPEQGSPMQKHQIYP
SEAQIPLGLCDKGDSGISGIVTKGESISALSMSSLERRKSRYAELDFEKIMHTRKRHQDM
FQDLNRKLQHAETESPTAESKLEKQQTPNKRPWEGVRTIQSPPWVTKDLEPVSPSPLELK
TVEWEKMGATIPLVGQDIIDLQTEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgaatttggaaaaggtgctcattccttccgtcacactaattgtcggctgtggggtctct
tcactcacactccttcttctgatcatcatatatgtctctgtctggaggtacatccgctct
gaacgatctgtcatactcattaacttctgcttgtccattatatcttcaaatgccttaata
ctcattggacaaacgcagacacgaaataaggtaatatgcactctcgtggctgcctttctt
catttcttcttcctttcctcattttgttgggtgctgacggaagcctggcagtcgtacatg
gctgtcacggggcgactgagaaaccggatcatccgcaagcgtttcctctgcctcggatgg
gggcttccagctctggtagtggcgatttctgtcggttttaccaaggcaaaggggtatgga
tctgccaattactgttggctatcacttgaaggagggctcctttatgcatttgtcggacca
gcagctgccgtcgtcttggtgaatatggttataggcatcctcgtattcaacaagcttgta
tccaaagatggcattgcagacaagaagctcaaggaacgggctggtatttgtgattttaat
tgcagtcagatgacaatgcccctatacggcatgacgctcaaatgttccaagtgtggaata
gtatcttcagcagaagtatccgccacagccaccagtaatgccatggcctcattatggagt
tcatgtgtggtgttaccgctcttggcgctcacgtggatgtcggcggttttggccatcacg
gacaggcggtctgctctcttccagatcctttttgctgtctttgattcactggaaggattt
gttattgtcatggtgcactgtatcctcagaagagaggtgcaggatgctgtgaaatgtcga
gttgttgatcaacaagaagaaggaaacggtgactctggggggtcctttcaaaatggacac
gctcagctaatgctggaagaagccaacaacccatacatctgcacggccatggttggtctc
aaggacaagaaaataccgtcggattttgagaaagacgtggattttgcatgtagatcagtg
ctaaacaaggacagctccacacttcgaacatctacaatcacaggaacactaaagcgacca
tctcttcaggatgaagaaaaaatgaagatgaaccaccagaaaggttccaacttcaatagt
cttccatccaatgcgtcaaaaattcaccatcaaggctctccacactacctaggaggtata
aacctgaatgagttcaacaaccatacactcacacttaaaaaggacaaaagccagtcctcc
aagcctatgtatatgtgtgaaggggacatctttaagaagttagattcagaactcacacgc
gctcaggagcagtccatggacccgagctatgttatattacccagcaacacatcaacgctg
agagcaaagccaaaagaagaaaacaaatacagtatgaacattgatcagatgccgcaaacc
aggctcatacaccttaatatggctgatcctagctacatgctaaaaagtccaccaagagaa
cgaattggcatgcagtgtcctgagcaggggtcaccaatgcaaaaacatcaaatttatccc
agtgaggcacagattccacttggcctttgtgataaaggagactcagggatatcaggaatt
gtaacaaagggcgaatccatctctgcactttcaatgagctccttggagagaagaaaatca
cgctacgcagagttagattttgagaaaattatgcacaccaggaaacgccaccaggatatg
tttcaagacttaaacagaaaactacaacatgcagagacagaatcccctactgcagagagc
aagttagaaaagcaacagacgccaaataagaggccatgggaaggtgtgagaacaatccag
tcaccaccttgggttacaaaagacctggaacctgtgtccccttctcccctagagctaaag
actgtggagtgggagaaaatgggagcaacgatacctctggttggacaagacataattgac
cttcagactgaagtctga

KEGG   Xenopus laevis (African clawed frog): 108718612
Entry
108718612         CDS       T01010                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108718612
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108718612
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108718612
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    108718612
Peptidases and inhibitors [BR:xla01002]
 Mixed peptidases
  Family P2
   108718612
Membrane trafficking [BR:xla04131]
 Endocytosis
  Phagocytosis
   Others
    108718612
G protein-coupled receptors [BR:xla04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   108718612
SSDB
Motif
Pfam: 7tm_2 TSP_1 GAIN TSP1_spondin GPS TSP1_ADAMTS HRM TSP1_CCN
Other DBs
NCBI-GeneID: 108718612
NCBI-ProteinID: XP_018122427
LinkDB
Position
6L
AA seq 1307 aa
MDSVLQYNTCQSIMRTDWNGAQAELYLYLWVSELLNPLATVLFPLIPTGDPAAEEWSPWS
VCSTTCGEGLKSRTRFCVSSSYSTPCSGPLKEHKQCNNSAVCPVNGIWAEWSPWSLCSST
CGRGFRERTRTCSPPQFGGNNCDGPEKQTKFCNIALCPVDGNWNDWSRWSACSASCSNGT
QKRTRECNGPSYGGSECYGQWSDTRDCFLTQCPVDGKWQNWGPWATCTTTCGGGIQKRER
TCYGPFYGGQPCPGSMEESKPCNEKKCPEPHEICPEETSTSVTWQETPAGEMTTVRCPRN
ATGLILRTCVLDDEGDAYWEPPTYIRCVSLDYRNIQQMIREHLAKAQRGLVGEGVSGVIQ
HLVDVTQEGSSYSGDVLSTIDSLRNITEIFRRAYHSPNNGDIQNFVQIISNLLSEENRDK
WEEAQTVGLSVKDLFKLIEDFIEVIGFRMKDFKDSYQVTDNLVLSIFKRPANSATDINFP
MKGWRGMADWAKNSEDKVSVSKSLLSTGDTDTDDSSIFIIGTVLYRNLGSILSLQRNTTV
LNSKIISVTVKPSPRSIAVPLDIEFSHMYNGTTNQTCIVWDETDTSSNLGAWSLKGCRTV
SVDSYHTKCSCDRLSSFAILAHLSSDMNMEKVLVPSVTLIVGCGVSSLTLLLLIIIYVSV
WRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFLSSFCWVLTE
AWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYGSANYCWLSLEGGLL
YAFVGPAAAVVLVNMVIGILVFNKLVSKDGIADKKLKERAGQMTMPLYGMTLKCSKCGIV
SSAEVSATATSNAMASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFV
IVMVHCILRREVQDAVKCRVVDQQEEGNGDSGGSFQNGHAQLMLEEANNPYICTAMVGLK
DKKVPSDFEKDVDLACRSVLNKDISTLRTSTITGTLKRPSLQDEEKMKMNHQKGSNFNSL
PSNVSKIHHQGSPHYLGGINLSEFNNHTLTLKKDKSQSSKPMYMCEGDIFKKLDSELTRA
QEQSMDPSYVILPSNTSTLRAKPKEENKYSMNIDQMPQTRLIHLNMADPSYMLKSPPRER
IGMKCPEQGSPMQKHQIHPNEAQIPLGFCDKGDSGISGIVTKGESISTLSMSSLERRKSR
YAELDFEKIMHTRKRHQDMFQDLNRKLQHAEKEKESPTAENKLEKQHTPNKRPWEGMRKI
QSPPSWVKKDLEPVSPLPLELKTVEWEKTGATIPLVGQDIIDLQTEV
NT seq 3924 nt   +upstreamnt  +downstreamnt
atggactcggttctccaatacaacacctgccaaagtataatgagaacagattggaatggg
gctcaggctgagttgtatctgtatctgtgggtatctgagctgttgaacccgcttgcaaca
gttttatttcccctcatcccaacaggtgacccagccgctgaggaatggtctccttggagc
gtttgttccaccacctgcggagaaggactcaaatccagaaccaggttctgcgtctcctcc
tcatacagcactccctgcagcggcccactcaaggagcacaagcaatgtaataactcagct
gtctgtccagtgaatggaatatgggctgaatggtcaccctggagcctttgttcatctaca
tgtggccgggggttcagggaaagaactcgcacttgttcccctcctcagtttggtggcaac
aactgtgatggaccagaaaagcaaaccaagttctgtaacatcgccttgtgcccagtggat
gggaactggaatgattggtcaagatggagtgcttgttctgcatcttgttccaatggtact
cagaaaaggactcgggagtgcaatggaccatcctatggtggatctgaatgttatggacaa
tggtctgacacaagagactgcttcttaacccagtgtccagttgatggaaagtggcagaat
tggggtccgtgggcaacatgcaccaccacttgtggtggagggatacagaaaagggaacgt
acatgctatggtcccttttatggagggcaaccttgtccaggatccatggaagaatcaaag
ccatgtaatgaaaaaaagtgtccagaaccgcatgagatttgccctgaggaaacttctact
tctgttacttggcaagaaaccccggcaggagagatgaccacggtccgatgtcctcggaat
gctacagggctcattctccgaacgtgcgttttagatgacgaaggtgacgcttactgggag
cccccgacatacatcagatgtgtttcccttgactaccgcaatattcagcagatgataagg
gagcaccttgctaaagcacagcggggcctcgttggagaaggagtgtccggggtaatacag
cacctggtggatgtaacgcaggaaggatccagctatagtggagatgtcttgtccaccatt
gactctttgaggaacataacggaaatattccgccgtgcttatcatagcccgaataatggt
gacatacagaattttgtacagatcatcagcaacttgctgtcagaagaaaacagagacaag
tgggaagaagcccaaacggtggggctgagcgttaaagatctgttcaaactgattgaagat
ttcatcgaagtcattggattccgcatgaaagacttcaaggactcctatcaagtgacggac
aacctggttctaagcatattcaagcggccggcaaacagtgcaacagacatcaacttcccc
atgaaaggctggagagggatggcggactgggccaagaactcagaagataaagtctctgtt
tccaagagcttgctatctactggcgatacagatacagatgactcgtccatcttcatcatc
ggaacagtgctctacaggaacctgggaagcatattgtctttgcagagaaacaccaccgtg
ctgaattctaagattatctccgttacggtgaaaccatcgcccagatctattgccgttcct
ctggatatcgagttctctcacatgtacaacggaaccaccaatcagacgtgcatcgtatgg
gatgaaactgacacatcatctaatctgggcgcctggtccctgaaaggctgtcgcacggtg
tccgtggattcctatcacactaaatgctcttgtgatcgtttatccagtttcgccatttta
gcccacctcagttctgacatgaatatggaaaaggtgctcgttccttccgtcacgctgatt
gtcggctgtggggtctcatcgctcacactccttcttttgatcatcatatatgtctctgtc
tggagatacatccgctctgaacgatctgtcatactcattaacttctgcttgtctattatc
tcttcaaacgccttaatactcattgggcaaacgcagacacgaaacaaggtaatatgcact
ctcgtggctgcctttctccatttcttcttcctttcctcattttgttgggtgctgacggaa
gcttggcagtcgtacatggctgtcacggggcgactgcgaaatcggatcatccgcaagcga
ttcctatgtctcggatgggggttgccagctctggtagtggcgatttctgttggtttcacc
aaggcaaagggatatggatctgccaattattgttggctatcgcttgaaggaggactactt
tatgcatttgttggaccagcagctgccgtcgtcttggttaatatggttataggcatcctg
gtattcaacaaacttgtgtccaaagatggcattgccgacaaaaagctcaaggaacgggct
ggtcagatgacaatgcccctatacggcatgacgctcaaatgttccaagtgtggaatagta
tcttcagcagaagtatccgccacagccaccagtaatgccatggcctcgttatggagttcg
tgcgtggtgttaccacttttggcgctcacatggatgtcagcagttttggccattacggac
agacggtctgcactcttccagatcctgtttgcagtctttgattctctggaaggttttgtc
attgtcatggtgcactgtatcctcagaagagaggtgcaggatgctgtgaagtgtcgagtt
gttgatcagcaagaagaaggaaatggtgactctggggggtcctttcagaacggacacgct
cagctaatgctggaagaagccaacaacccatacatctgcacggccatggttggtctcaag
gacaagaaagtgccgtcagattttgagaaagacgtggatttggcatgtagatcagtgcta
aacaaggacatctctacacttcgaacatctacaatcacaggaacactaaaacgaccatct
cttcaggatgaagaaaaaatgaagatgaaccaccagaaaggttccaacttcaatagtctt
ccatccaatgtgtcaaaaattcatcatcaaggctctccgcactacctagggggtataaac
cttagtgagttcaacaatcatacactcacacttaaaaaggacaaaagccaatcctccaag
cctatgtatatgtgtgaaggggacatctttaagaagttagattcagaactcacacgagct
caggagcagtccatggacccaagctatgtcatcttacccagcaacacatcaactctgaga
gcaaagccaaaagaagaaaacaagtacagtatgaacattgaccagatgccacaaaccagg
cttatacaccttaatatggctgatccaagctacatgctgaaaagtccaccaagagagcga
attggcatgaaatgtcctgagcaggggtcaccgatgcaaaaacatcaaattcatcccaac
gaggctcaaattccacttggcttttgtgataaaggagactcagggatatcaggaattgta
acaaagggcgaatccatctccacactttcaatgagctccttggagagaagaaaatcacga
tatgcagagttagattttgagaaaattatgcacaccaggaaacgccatcaggatatgttt
caagacttaaacagaaaacttcaacatgcagagaaagagaaagaatcccctactgcagag
aacaagttagaaaagcaacatacaccaaataagaggccatgggaaggtatgagaaaaatc
cagtccccaccatcatgggttaaaaaagacctggaacctgtgtcccctttgcccctagag
ctaaagactgtggagtgggagaaaacaggagcaacgatacctctggttggacaagacata
attgaccttcagactgaagtctga

KEGG   Xenopus laevis (African clawed frog): 108719769
Entry
108719769         CDS       T01010                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108719769
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108719769
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108719769
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    108719769
Peptidases and inhibitors [BR:xla01002]
 Mixed peptidases
  Family P2
   108719769
Membrane trafficking [BR:xla04131]
 Endocytosis
  Phagocytosis
   Others
    108719769
G protein-coupled receptors [BR:xla04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   108719769
SSDB
Motif
Pfam: TSP_1 GAIN TSP1_spondin TSP1_ADAMTS HRM TSP1_CCN
Other DBs
NCBI-GeneID: 108719769
NCBI-ProteinID: XP_018124415
LinkDB
Position
6S
AA seq 546 aa
MGYPAPQIGDPAAEEWSPWSICSATCGEGLKSRTRFCVSSSYSTHCSGPLKEHKQCNNSA
CPVDGIWAEWSPWSLCSSTCGRGFRERTRTCTPPQFGGNNCDGPEKQTKFCNIASCPDLS
LVDGNWNDWSSWSACSASCSNGTQKRTRECNGPSYGGSECYGQWSDTRDCFLTQCPVDGN
WQNWGSWAACTSTCGGGIQKRERTCYGPFYGGEPCPGSMEESKPCNEKKCPEPHEICPEE
TSASVTWQETPAGEMATLRCPRNSTGLILRTCILDDEGDAYWEPPTYIKCVSLDYRNIQQ
MIREHLAKAQRGLVGEGVSGVIQHLVDVTQEGSSYSGDVWSTVDSLRNITEIFRRAYHSP
TSGDIQNFVQIISNLLSEENRDKWEEAQMVGLSVKDLFKLIEDFIEVIGFRMKDFKDSYQ
VTDNLVLSIFKRPANSATDINFPMKGWRGMADWAKNSEDKVSVSKSLLSTGDTDDSSIFI
IGTVLYRNLGSILSLQRNTTVLNSKIISVTVKPSPRSIPVPLDIEFSHMYNGTTNQTCIV
WDETDM
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgggctacccggcacctcaaataggtgacccagcggcagaggaatggtctccttggagc
atttgttccgctacctgcggagagggactcaaatccagaaccagattctgcgtctcctcc
tcatacagtactcactgcagcggcccactcaaggagcacaagcaatgtaataactctgcc
tgtccagtggatggaatatgggctgaatggtcaccctggagcctttgttcgtctacatgt
ggccgggggttcagggaaagaactcgaacttgtacccctcctcagtttggtggcaacaac
tgtgatggaccagaaaagcaaaccaagttctgtaacatcgcctcatgcccagatttatct
ctagtggatggaaactggaatgattggtcaagctggagtgcttgttctgcgtcttgttcc
aatggtactcagaaaaggactcgggagtgcaatggaccatcctatggtggatctgaatgt
tatggccaatggtctgacacaagagactgctttttaacacagtgtccagttgatggaaat
tggcagaattgggggtcgtgggcagcgtgcaccagcacctgtggaggaggcatacagaaa
agggaacgtacatgttatggccccttttatggaggggaaccttgcccaggatccatggaa
gaatccaagccatgtaatgaaaaaaagtgtccagaaccgcatgagatttgccctgaggaa
acttctgcttctgtcacttggcaagaaaccccggcaggagagatggccacgctccgatgt
cctcggaattctaccgggcttattctccgaacctgcattttagatgacgaaggcgacgct
tactgggagcccccgacatacatcaaatgtgtttcccttgactaccgcaatattcagcag
atgataagggagcaccttgctaaagcacagcggggcctcgttggagaaggagtatccgga
gtaattcagcatctagtggatgtaacacaggaaggatccagctacagtggagatgtctgg
tccaccgttgactctttgaggaacattacggaaatatttcgccgtgcttatcacagtccg
actagtggcgacatacagaattttgtacagatcatcagcaacttgctgtcagaagaaaac
agagacaagtgggaagaagcccaaatggtgggactgagcgttaaagatctgttcaaactg
attgaagatttcatcgaagtcattggattccgaatgaaagacttcaaggactcctatcaa
gtgacggacaacctggttctaagtatcttcaagcgtccagccaacagtgcaaccgacatc
aacttcccaatgaaaggctggagagggatggcggactgggccaagaactcagaagataaa
gtctccgtttccaagagcttgctatctactggggatacagatgactcgtccatcttcatt
attggaacagtgctctacaggaacctgggaagcattctgtccttgcagagaaacaccacc
gtgttgaattctaagattatctccgttacggtgaaaccgtcgcccagatctattcccgtt
cctctggatatcgagttctcccacatgtacaatggaaccaccaatcagacgtgcatcgta
tgggatgaaactgacatgtaa

DBGET integrated database retrieval system