KEGG   Xenopus laevis (African clawed frog): 108696050
Entry
108696050         CDS       T01010                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108696050
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108696050
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108696050
   04217 Necroptosis
    108696050
   04115 p53 signaling pathway
    108696050
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108696050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xla04050]
    108696050
   04090 CD molecules [BR:xla04090]
    108696050
Cytokine receptors [BR:xla04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108696050
CD molecules [BR:xla04090]
 Proteins
  108696050
SSDB
Motif
Pfam: TNFR_c6 Death BTRD1
Other DBs
NCBI-GeneID: 108696050
NCBI-ProteinID: XP_018080527
UniProt: A0A1L8FII3
LinkDB
Position
7L
AA seq 314 aa
MLLPWICLFITLAVERNSASAIHNIEDSSNTFIAKPSLSLHKVFKRQSKCLDWQYPGNQF
CCGKCPAGTRVENDCQKEHENSTCIPCTEGKDYMDQLNGYNQCLRCKPCDQEQEVDSPCT
VFHDTVCKCKANYFCSSNTSQDPRICDHCLPCTQCGNGIAEKCTATKDTVCKGSRSHWAA
LGALIPLVVCAVVCVRCRQKTRIIVPPRAPQAEPYPSYLKDIDLEPHLQDLAGKMLYEQM
VQCVRKMDLTEPVIDDIKNSHGKGFEGKYQLLRSWYTYHGQTGAFQQLIETLQERGFNRP
AQNIIDFLKSKVQP
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttattgccctggatctgcctgtttatcacactggcagtggaaaggaattctgcatct
gcaatacataatatagaagattcctcaaacacattcattgctaaaccatcattgtcactg
cacaaggtttttaaaagacaatcaaaatgtctagattggcaatatcctggtaatcaattc
tgctgtgggaaatgtccagctgggacccgtgtagagaatgactgtcagaaagaacacgag
aactccacctgtataccttgcactgaagggaaggattatatggaccaactcaatggttac
aatcagtgcctccgctgcaaaccatgtgaccaggaacaagaagttgattccccttgcaca
gtctttcacgatacggtgtgtaaatgcaaagccaattatttctgcagttcaaataccagc
caagaccccaggatctgcgatcactgtctgccctgtacccagtgtggaaacggcattgca
gaaaaatgcacagcgacaaaagacacggtgtgcaaaggtagccggagccactgggcggca
ttaggagcactgataccactggttgtgtgtgcagttgtgtgtgtaagatgcagacaaaag
acaaggatcatagttccgccacgagctccccaagctgagccttatccttcataccttaaa
gatattgatttggaacctcatctacaagacctggctggtaaaatgctgtacgagcagatg
gtacaatgtgtaagaaaaatggatctaacggaacctgtcatagatgacattaaaaacagc
catggaaaaggctttgaaggaaagtaccagttgctgagaagctggtatacgtatcacggc
cagacgggggcatttcagcaactcattgaaactctccaagagcgcggcttcaatagacct
gcacagaatatcattgattttttaaaaagtaaagtgcagccctaa

KEGG   Xenopus laevis (African clawed frog): 108697171
Entry
108697171         CDS       T01010                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108697171
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108697171
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108697171
   04217 Necroptosis
    108697171
   04115 p53 signaling pathway
    108697171
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108697171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xla04050]
    108697171
   04090 CD molecules [BR:xla04090]
    108697171
Cytokine receptors [BR:xla04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108697171
CD molecules [BR:xla04090]
 Proteins
  108697171
SSDB
Motif
Pfam: TNFR_c6 Death DHHC CARD_2
Other DBs
NCBI-GeneID: 108697171
NCBI-ProteinID: XP_018082585
LinkDB
Position
7S
AA seq 299 aa
MLLSWICLFVALAVERNSASVIHNIEDPTNTNIGNRSVSLRKVFRRDSKCPEGEYPGNKF
CCMNCAVGTRVENDCQEEHEKPTCIPCTDGKDYMDKANGYHECLLCRLCDQEHGEEVNFP
CTVSRNTVCKCRASYFCRTNSSQDPRSCDHCQQCTQCENGVAERCTETTDAVCKGYRYYW
ALLILLPLIVLAVCAVFKFVPSYLKDIDLEPYLQDLAGEMFYEQMVQCVRRMCLGDPTID
DIKNNHGQGSEGKYQLLRSWYTQHGQQGAFQKLIESLRECGLNRPAENIINILNSKVPH
NT seq 900 nt   +upstreamnt  +downstreamnt
atgttattgtcctggatctgcctgtttgtcgccctggcagtggaaaggaattctgcatct
gtaattcataatatagaagatcccacaaacacaaacattggcaatagatcagtgtcactg
cgcaaggtttttagaagagactcaaaatgtccagaaggggaatatcctggaaataaattc
tgctgtatgaactgtgcagttgggacgcgtgtcgagaacgactgtcaggaggagcacgag
aaacccacctgtattccttgcactgatggaaaagattatatggacaaagccaatggctac
catgagtgtctcctctgcagactgtgtgatcaggaacatggagaggaagtcaatttccct
tgtacagtctctcggaataccgtgtgtaaatgcagagccagttatttctgccgtactaat
tccagccaagaccccaggagctgcgatcactgtcagcaatgtacccagtgtgaaaacggt
gttgcagaaagatgtacagagacaacagacgcagtgtgcaaagggtaccgatactactgg
gcactgctgatattactgccactgatagtactggctgtgtgcgcagttttcaagtttgta
ccttcataccttaaagatattgatttggaaccgtatctacaagacttggctggtgaaatg
ttctatgagcagatggtgcaatgtgtaagaagaatgtgtctcggtgatcctaccatagat
gacattaaaaacaaccacggacaaggctctgaaggaaagtaccagttgctgagaagctgg
tatacacaacatggtcaacaaggggcatttcagaaactcattgaaagtctcagagaatgt
ggcctcaatagacctgcagaaaatatcattaatatattaaacagtaaagtgccgcattaa

DBGET integrated database retrieval system