KEGG   Xenopus laevis (African clawed frog): 108696140Help
Entry
108696140         CDS       T01010                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00480  Glutathione metabolism
xla00980  Metabolism of xenobiotics by cytochrome P450
xla00982  Drug metabolism - cytochrome P450
xla00983  Drug metabolism - other enzymes
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108696140
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108696140
   00982 Drug metabolism - cytochrome P450
    108696140
   00983 Drug metabolism - other enzymes
    108696140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    108696140
Enzymes [BR:xla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108696140
Transporters [BR:xla02000]
 Other Transporters
  Pores ion channels [TC:1]
   108696140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5 SAP
Motif
Other DBs
NCBI-GeneID: 108696140
NCBI-ProteinID: XP_018080704
UniProt: A0A1L8FJ87
LinkDB All DBs
Position
7L
AA seq 241 aa AA seqDB search
MTGSEKCLAKGCPAPGPVPEGTIRVYSMRFCPYAQRARLVLLAKGIKHEVININLKNKPD
WFFEKSPFGLVPSLETSNGQVIYESPIVCDYLDEVYPGKKLTPADPFQKAQQKMTLEHFS
KVTAVLYKIMGAKKNNEDISGVKEELQEKLLKLDEILAKQHSLFFGGSEVSMVDYMIWPW
FERLIMFDAKDCLNKTPLIDKWYQQMLQDPVVKATYIEPDVLLGFFKLYIQGDLEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactggatcagagaagtgtttggcaaaaggctgcccagctccaggcccagtccctgaa
ggaacaattcgtgtctacagcatgagattctgcccatatgcccagagggcaaggcttgtc
ttgcttgccaaaggaatcaagcatgaagtaataaatatcaatctgaagaacaagccagat
tggttctttgagaaaagcccatttggcctggtaccatctctggagaccagcaatggccag
gtgatctatgaatctccaattgtgtgtgattatctggacgaggtttatccagggaagaag
ctgacccctgcagacccattccagaaagcgcaacaaaagatgacactggaacatttctcc
aaggtcacagctgtgctgtataagataatgggtgccaagaaaaataatgaagacatatca
ggtgtgaaagaagaactccaggagaagttgcttaagcttgatgagatcctggctaaacaa
cacagccttttctttggtggaagtgaggtctctatggttgactacatgatttggccctgg
tttgaacggctcatcatgtttgatgcgaaggattgtttgaataaaaccccactcattgat
aagtggtatcaacagatgctgcaggatccagtggtcaaggcaacatatattgaaccagac
gtcctgttaggcttttttaagctgtacatccagggagatctggaggcttgtgattatggt
ctctaa

DBGET integrated database retrieval system