KEGG   Xenopus laevis (African clawed frog): 108696277
Entry
108696277         CDS       T01010                                 

Gene name
LOC733728.L
Definition
(RefSeq) novel protein L homeolog
  KO
K08774  transforming growth factor, alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108696277 (LOC733728.L)
   04012 ErbB signaling pathway
    108696277 (LOC733728.L)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 108696277
NCBI-ProteinID: XP_018080990
Xenbase: XB-GENE-5893075
UniProt: A0A1L8FK46
LinkDB
Position
7L
AA seq 142 aa
MLDMYGALAFLLAGIPVCLGENVTVGMQNSTFMPKSSSQSMFAECPDKYTNFCYYGTCRF
LISEWEASCICFKGYIGSRCQYVDLLQVMALDPRSFTVAAIAVTLLVALSLIGSTYLGVY
LCRVKRERSRLSLLKNMESQEV
NT seq 429 nt   +upstreamnt  +downstreamnt
atgttagacatgtatggagcacttgcatttctattggcaggtattccagtctgtttgggt
gaaaacgttactgttggaatgcagaactcaacatttatgccaaagtcctcttcccagagc
atgttcgctgaatgtccggataaatacaccaatttctgttattatggcacatgccggttc
ctcatatctgagtgggaggcttcttgcatatgcttcaaaggatatattggaagccgttgc
caatatgtagacctgttgcaggttatggcattggaccctcgctcattcactgtagcagct
atagcagtcactttattggttgcactgtcgttaatagggagcacataccttggtgtctac
ttgtgtagagtaaagagggaaagaagccggctttctcttctgaaaaacatggagagccaa
gaagtttaa

DBGET integrated database retrieval system