KEGG   Xenopus laevis (African clawed frog): 108696394
Entry
108696394         CDS       T01010                                 

Gene name
chek1.L, Chk1, XChk1
Definition
(RefSeq) checkpoint kinase 1 L homeolog
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108696394 (chek1.L)
   04115 p53 signaling pathway
    108696394 (chek1.L)
   04218 Cellular senescence
    108696394 (chek1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108696394 (chek1.L)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    108696394 (chek1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108696394 (chek1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108696394 (chek1.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108696394 (chek1.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 108696394
NCBI-ProteinID: XP_018081197
Xenbase: XB-GENE-17335159
UniProt: A0A1L8FL95
LinkDB
Position
7L
AA seq 510 aa
MCDVSISCPKRSQKLAGVLNIGPGLRAVSRKSYKNNMAVPFVEDWDLVQTLGEGAYGEVQ
LAVNRKTEEAVAVKIVDMTRAADCPENIKKEICINRMLSHTNIVRFYGHRREGKIQYLFL
EYCRGGELFDRIEPDVGMPEQDAQKFFQQLIAGVEYLHSIGITHRDIKPENLLLDDRDHL
KISDFGLATVFRHNGKERLLNKMCGTLPYVAPELIKSRAFHAEPVDLWSCGIVLTAMLAG
ELPWDQPNEVCQEYCDWKEKNHYLTPWKKISATPLALLCKMLTENPQSRITIPDIKKDRW
FTEVIKKGLKRSRFMSGGSSDSSVLCKQIRSDIDLSHISHSEDKTAYSSTQPEPRTALAA
WDSNSSDINNLVQGKGISFSQPACPDNMLLSSQLIGTPGSSQNVWQRLVKRMTRFFTKVD
AESSYSNLMDNCEKMGYVLKKSCANQVTLSTTDRRNNKLIFKVNLVEMEDRILLDFRLSK
GDGLEFKRHFLKIKKKMDAIVAVQKVVPAS
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtgtgacgtttcgattagctgtccgaaaaggagccagaagttagcgggagttttaaac
atcggtccgggactgcgggctgtgtcaagaaaatcatacaaaaacaacatggcagttcca
tttgttgaagactgggatcttgtccagactcttggggaaggggcatatggagaagtgcag
ctggcagtgaacaggaaaaccgaggaagccgtagcagtgaagattgtagacatgacgcgt
gccgcggattgtccagaaaacatcaaaaaggagatctgtatcaataggatgcttagtcac
acgaatattgtaagattttatggacatcgaagggaaggcaaaattcagtacctctttctg
gagtattgtcgaggtggtgagctctttgatcgcatagaacctgacgttggaatgcctgag
caagatgcacagaaattttttcagcaactgattgctggtgtggaatacctgcacagcatt
ggaataactcacagagatattaagcctgagaacttacttttagatgacagagatcatctg
aaaatctctgactttggtttagcaacggtgttcagacacaatggcaaagaaagactttta
aacaagatgtgtggaacccttccctatgttgcaccagaactcattaagtccagggctttt
catgcagagccagtggatttgtggtcatgtggaattgtactgactgccatgttagcagga
gagttaccatgggatcagccaaacgaagtatgccaggagtattgtgactggaaggaaaaa
aatcactatctcactccatggaaaaaaataagtgctacccctctagcattgctgtgtaaa
atgttaacagaaaatccacaaagcagaataaccattccagacataaagaaggaccgctgg
tttacagaagttattaagaaaggacttaagagaagccgctttatgtctggaggctcttca
gattcttcagtgctttgtaagcagatccgatcagatattgatctctcgcacatctctcac
agtgaagacaaaactgcatattctagtacacaaccagagccacggactgccttggcagca
tgggacagcaatagttctgacataaacaatttggtgcaaggaaaaggcatcagtttctct
cagcctgcctgtcctgacaacatgcttttgagcagccagttgattggtactccaggttcc
tctcagaatgtttggcaacgtttagtcaaaaggatgaccaggttctttacaaaagtggat
gctgaaagctcatatagcaatttgatggacaattgtgaaaagatgggatatgttttaaag
aagtcttgtgctaaccaggtgaccctatcaactactgacagaagaaataataaattaatc
tttaaggtgaaccttgtggaaatggaagacaggattctgttagattttagactttctaag
ggtgatgggctggagtttaaaaggcatttcctgaagatcaaaaagaagatggatgctatt
gttgcagtccaaaaagttgtgcctgcttcctga

KEGG   Xenopus laevis (African clawed frog): 398191
Entry
398191            CDS       T01010                                 

Gene name
chek1.S, chek1, chk1
Definition
(RefSeq) checkpoint kinase 1 S homeolog
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398191 (chek1.S)
   04115 p53 signaling pathway
    398191 (chek1.S)
   04218 Cellular senescence
    398191 (chek1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    398191 (chek1.S)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    398191 (chek1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398191 (chek1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   398191 (chek1.S)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    398191 (chek1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH CoV_NSP3_C
Other DBs
NCBI-GeneID: 398191
NCBI-ProteinID: NP_001082039
Xenbase: XB-GENE-866102
UniProt: Q6DE87 A0A1L8FFS1
LinkDB
Position
7S
AA seq 474 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRKTEEAVAVKIVDMTRAADCPENIKKEICINR
MLSHTNIVRFYGHRREGNIQYLFLEYCRGGELFDRIEPDVGMPEQDAQKFFQQLIAGVEY
LHSIGITHRDIKPENLLLDERDQLKISDFGLATVFRHNGKERLLSKMCGTLPYVAPELIK
SRAFHADPVDVWSCGIVLTAMLAGELPWDQPNEVCQEYCDWKEKNHYLTPWKKISATPLA
LLGKMLTENPQSRITIPDIKKDRWFTEIIKKGLKRSRVISGGSSDSSVLCKQIRSDIDIS
HFSHSEEKTALSSTQPEPRTALATWDSNSSDINNLVQGKGISFSQPACPDNMLLNSQLIG
TPGSSQNVWQRLVKRMTRFFTKVNAESSYSNLMDTCEKMGYVLKKSCANEVTLSTTDRRN
NKLIFKVNLVEMEDRILLDFRLSKGDGLEFKRHFLKIKKKMDAVVAVQKVLSAT
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcagttccgtttgttgaagactgggatctggtccagactcttggagagggggcatat
ggagaagtgcagctggcagtgaaccggaaaactgaagaagcggtagcagtgaagattgtg
gacatgacacgtgcagctgattgcccagaaaacatcaaaaaggagatctgtatcaatagg
atgctcagtcacacaaatattgtaagattttatggacatcgaagggaaggcaacattcag
tacctctttctggagtattgtcgaggtggtgagctctttgatcgcatagagcctgatgtt
ggaatgcctgagcaagatgcacagaaattttttcagcaactgattgctggtgtggaatac
ctgcacagcattggaataactcacagagatatcaagcctgagaacttgcttttagatgaa
cgagatcagctgaaaatctctgactttggtttagcaacggtattcagacacaatggcaaa
gaaagacttttaagcaagatgtgtggaacccttccctatgttgcaccagaactgattaaa
tccagggcctttcatgccgacccagtggatgtgtggtcatgtggaattgtgctgactgcc
atgttagcaggagagttaccatgggatcaaccaaacgaagtatgccaggagtattgtgat
tggaaggaaaaaaatcattatctcactccatggaaaaaaattagtgctacccctcttgca
ttgctgggtaaaatgttaacagaaaatccacaaagcagaatcactattccagacataaag
aaggaccgttggtttacagaaataatcaaaaaaggacttaagagaagccgcgttatctcc
ggaggctcttcagattcttcagtgctttgcaagcagattcgatcagatatagatatttca
cacttctctcacagcgaagagaaaactgcactttcaagtacgcaaccagagccacggact
gcattggcaacatgggacagcaatagttctgacataaacaatttagttcaaggaaaaggc
atcagtttctctcagcctgcctgtcctgacaacatgctgctgaacagccagttgattggt
actccaggctcctctcagaatgtttggcagcgtttggtcaaaaggatgaccaggttcttt
acaaaagtgaatgccgaaagttcttatagcaatttgatggacacttgtgaaaagatggga
tatgttttaaagaagtcttgtgctaacgaggtgaccctatcaactactgacagaagaaat
aataaattaatatttaaggtgaaccttgtggaaatggaagaccggattctgttagatttt
agactttctaagggtgatgggctggagttcaaaaggcattttctgaagatcaaaaagaag
atggatgctgttgttgcagtccaaaaagttctgtctgccacttga

DBGET integrated database retrieval system