KEGG   Xenopus laevis (African clawed frog): 108696395
Entry
108696395         CDS       T01010                                 

Gene name
ei24.L
Definition
(RefSeq) etoposide induced 2.4 L homeolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108696395 (ei24.L)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 108696395
NCBI-ProteinID: XP_018081199
Xenbase: XB-GENE-17342217
UniProt: A0A1L8FL56
LinkDB
Position
7L
AA seq 340 aa
MADSLRTFLNDLTRGIKDSIWGICTISKLDARIQQKREEQRKRRANSALAQRRAQNEERK
PENEPRIVTRIFQCCAWNGGVFWLSLFLFYRMFIPLLQTVTARIIGDPSLHGDVWSWLEF
ILTSVFSALWVLPLFVLSKVVNAIWFQDIADLAFELSGRKPQPFSSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIDVIGQIISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLASLTAMQSSYIISGCLFSILFPLFIISANEAKTPVKVYHFQLRLFSLVVFL
SNRLFHKTVYIQSTISSSGSSEKLPSPHPSPAKQKATLGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgacagcttaaggacctttctcaatgatcttacccgtggaatcaaagactccatt
tggggaatatgcacaatttcaaagctggatgccagaattcagcagaagagggaggaacag
aggaagaggcgagctaacagtgctcttgcacagaggagagcccaaaatgaagaaagaaag
ccagaaaatgaaccacgcattgttaccaggatctttcaatgctgtgcatggaatggtggt
gtattctggttgagcctcttcttgttttatcgaatgtttatcccacttcttcaaacggtt
acagcacgtataattggggatccatccttacatggagatgtctggtcttggctcgaattt
atcctcacttctgtttttagtgccctatgggttctccctctgttcgtcctcagtaaagtt
gttaatgccatctggttccaggatattgcagatttggcatttgagctgtcaggaagaaaa
cctcaacccttttcaagtgttagtaaaattatagctgacatgctattcaaccttcttcta
caagcacttttcctgatccagggaatgtttgtgagcctgtttcccattgatgtcattggc
cagatcattagtcttcttcacatgtctttgctctactcgctgtactgctttgaatatcgg
tggttcaacaaaggaatagaaatgcatcagcggttatccaacattgaaagaaactggcct
tactactttggattcggtttacccttggcttcactaactgccatgcagtcatcgtatatt
attagtggctgtttgttctctattcttttcccactgtttattatcagtgctaatgaagct
aaaacacctgtgaaagtgtaccatttccagctccgtctcttttctctcgtcgtgttcctg
agcaacagactctttcacaagactgtctatattcagtctacgataagcagctctggttcc
tctgaaaaacttcccagccctcacccatctcctgccaaacagaaagccactttgggacac
tga

KEGG   Xenopus laevis (African clawed frog): 444383
Entry
444383            CDS       T01010                                 

Gene name
tp53i3.S, tp53i3
Definition
(RefSeq) tumor protein p53 inducible protein 3 S homeolog
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    444383 (tp53i3.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     444383 (tp53i3.S)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2
Other DBs
NCBI-GeneID: 444383
NCBI-ProteinID: NP_001085954
Xenbase: XB-GENE-953480
UniProt: Q6GNC3
LinkDB
Position
5S
AA seq 336 aa
MEDKMLAAFFDAPGGPETLYIKEVAKPEPKEGEVLIKVEASALNRADLLQRRGKYAPPPG
SSDILGLEAAGTVVKLGPGADGSWKVGDGVMALLSGGGNAQYVTVPAGHLIPIPPGMSAT
DAAAIPEAWLTAFQLLHFVGKVQKGETVLIHAGASGVGTSAIQLCRLAGAVPIVTAGSPD
KLQMAVKLGAATGFNYKEENFGEKCLEFTNNTGADVILDCIGGTHWEKNLQCIKTDGRWV
LYGLMGSGEIHGDLLANLLRKRGSILGSLLRSRSKKYKEELVKAFTEQALPHFMPGGSVQ
LQPIVDSVFPLDQIADAHQRMEDNKNTGKIVLQMPL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggaggataaaatgttagcagcatttttcgatgctcctggcggcccagagacgttgtac
attaaagaagtggctaaacctgagccaaaggagggggaagtgcttataaaggttgaagcc
agtgccttgaaccgggcagacttacttcagagaaggggaaaatacgctccacctccaggt
tccagtgacattctgggtttggaagctgctggcacagtggttaagcttggcccgggtgct
gatgggagctggaaggtcggagatggagttatggcgcttctgtctggtggtggaaatgca
caatatgtcactgtaccagcgggacatctcattccaattccccctggaatgtctgcaacc
gatgctgctgccatccctgaggcctggctcactgcttttcaactgctgcactttgtaggt
aaagttcagaaaggagagactgtcctgattcacgccggtgccagtggagttggtacttcg
gccatccagttgtgccgcctggctggggcagttcctattgtaacggcagggtcgccagat
aagctgcagatggcagtaaaattgggagctgcaactggattcaattacaaagaagagaac
tttggtgaaaagtgtcttgagttcaccaataatactggggcagatgttatactggactgc
attggagggacacactgggagaagaacttgcagtgcattaaaacagacggccgctgggtt
ctctacgggctgatgggttccggtgagattcatggggatctgctggcaaatttactgcgg
aaaagagggagcatattgggcagcttgttaagatctcgctcaaagaagtacaaggaggaa
ctggttaaggccttcacagaacaagctctgccacatttcatgcctggggggtccgtccag
ctgcagccaattgtggacagcgtatttcccttggatcagattgctgatgcccaccagcga
atggaagacaacaaaaacacaggcaaaattgttctacagatgcccctgtga

KEGG   Xenopus laevis (African clawed frog): 495297
Entry
495297            CDS       T01010                                 

Gene name
ei24.S, ei24
Definition
(RefSeq) etoposide induced 2.4 S homeolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    495297 (ei24.S)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 495297
NCBI-ProteinID: NP_001088433
Xenbase: XB-GENE-990265
UniProt: Q5U5D1
LinkDB
Position
7S
AA seq 340 aa
MADSLRTFLNDLTRGIKDSIWGICTISKLDARIQQKREEQRKRRASSALAQRRAQNEERK
PENEPRIVTRIFQCCAWNGGVFWLSLFLFYRMFIPLLQTITARIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFELSGRKLQSFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIDVIGQIISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLASLTAMQSSYIISGCLFSILFPLFIISANEAKTPVKVYHFQLRLFSLVVFL
SNRLFHKTVYLQSTLSSSGSSEKLPSPHPSPAKQKATLGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgacagcttaagaaccttccttaatgaccttacccgtggtattaaagactccatt
tggggaatatgcacaatctcaaagctggatgccagaattcagcaaaagagggaggaacag
aggaagaggcgagctagcagcgctcttgcacagaggagagcccaaaatgaagaaagaaag
ccagaaaacgaaccacgcattgttaccaggatctttcagtgctgtgcttggaatggtggt
gtattctggttgagcctcttcttgttttaccgaatgtttatcccacttcttcaaactatt
acagcacgtataatcggggatccatccttacatggagatgtctggtcttggctcgaattt
atcctcacttctatttttagtgccctatgggttctccctctattcgtcctcagtaaagtt
gttaatgccatctggttccaggatattgcagatttggcatttgagttgtctggaagaaaa
cttcaatcctttccaagtgtcagtaaaattatagctgacatgctgttcaacctccttcta
caagcacttttcctgatccagggtatgtttgtgagcctgtttccgattgatgtcattggc
cagatcataagtcttcttcatatgtctttgctctactcactgtactgctttgagtatcgg
tggttcaacaaaggaatagaaatgcatcagcggttatccaacattgaaaggaactggccc
tactactttggatttggtttacccttggcttcactaactgccatgcagtcatcgtatata
attagtggctgtttgttctctattcttttcccattgtttattatcagtgcgaatgaagct
aaaacacctgtgaaagtgtaccactttcagcttcgtctcttttcactggtcgtcttccta
agcaacagactcttccacaagactgtctatctccagtctacgctaagcagctctggttcc
tctgaaaaactgcccagccctcacccatctcctgccaaacagaaagccactttggggcac
tga

DBGET integrated database retrieval system