KEGG   Xenopus laevis (African clawed frog): 108696624
Entry
108696624         CDS       T01010                                 

Definition
(RefSeq) tumor protein p73-like
  KO
K10148  tumor protein p73
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108696624
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108696624
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    108696624
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 108696624
NCBI-ProteinID: XP_018081641
UniProt: A0A1L8FMK1
LinkDB
Position
7L
AA seq 752 aa
MIQQLPHPPPNQLLFCTSLSQLMSPMRQCPKQVSSPAKWGPGDEEVNRKALRVAVRIHCN
CQLLARTDRARGSLISSFGRSQPSTFMQATLIKQRAVQGTISTDWHFRVIYPLQESPSVK
MSQSSGADEGTTFEHLWSTLEPDSTYFELPQSSHSNNTEASNRADVNMDVYQMRSMNESI
MSQFNLLNNTMDQSIGSRAASTSPYNPDHTSNVPTHSPYSQPSSTFEAMSPAPVIPSNTD
YPGTHNFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLSNQPPPGSVIRAMPV
FKKAEHVTEVVKRCPNHELGRDFNDGQAAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPF
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR
DRKADEDHFREQAALNETAAKNGNANKRTFKQSPPSAQTVGANIKKRRHGEDEIFYIPVR
GRENFEILMKIKESLELVELVPQQLVDSYRQQQQQLLQRQTHMQCASSYGPALSPMNKLH
GGINKLPSVNQLVGQPNQHNSNAGPNLGPMGPGMLNSHPLQTNGEMNGAHSSQSMVSGSH
CTPPPPYSADPSLVSFLTGLGCPNCIEYFTSQGLQNIYHLQNLTMEDLGALKIPEHYKAM
IWRGIQELNKSHDYGAQQLVRSSGNGSSISIGSSGELQRQRVMEAVHFRVRHTITIPNRG
GADEWADFGFDLPDCKSRRQSIKEEYENSDIN
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgatccagcaactgccacatccaccccctaatcaactcctcttctgcacgtcactttca
cagctaatgtcgccaatgcggcaatgcccaaaacaggtgtcatcgcctgctaagtggggg
cccggcgatgaagaggttaataggaaggctttgcgagtggcagtccggattcattgcaac
tgtcagctgctagcccggacagacagggcaagaggatcgctcatcagctcttttggcaga
tcccagccaagcactttcatgcaagcgacactcatcaagcagagggcagtgcaggggact
atcagcacagactggcatttcagagtgatataccctttgcaggaatccccttctgtaaag
atgtcccagtcttctggagcagatgaagggacgacatttgagcacctctggagtacccta
gagccagacagcacctattttgaacttccccaatcaagtcattcaaacaatactgaagca
tccaatcgagctgacgtcaacatggatgtttatcaaatgaggagcatgaatgaatctatc
atgtcccagttcaatctgctgaacaacaccatggatcagagtatcggcagcagagcggcc
tccactagtccctacaaccctgatcatacttcgaatgttcctacacattccccctactca
cagcccagctccacgtttgaggccatgtcacctgctcccgtcattccttccaacacagac
tacccaggaacacacaactttgaggtgacattccagcaatccagtacagccaagtcagcc
acatggacgtattctcctttgctgaaaaagctgtactgccagatagctaagacatgtccc
atccaaatcaagttgtctaatcaaccaccgcctggttcagtcattcgggcaatgccggtg
tttaagaaagcagaacatgtgactgaggttgtgaaacgatgtcccaatcatgaacttggg
cgtgactttaatgatggccaagcagccccagcaagccatctgatacgagtggaaggcaat
aacttatctcagtatgtggatgacccagtaacaggtcggcaaagcgttatggtgccgttc
gaaccaccccaggttggaacagagttcaccacaatactctacaacttcatgtgcaacagt
agctgtgtgggaggaatgaacaggcggcctattctgatcattattactctggaaacaaga
gatgggcaagtattgggcagaaggtcttttgaaggtcgtatctgtgcctgtccgggcaga
gaccgtaaggctgatgaggatcacttccgggagcaagcagcattaaacgaaacagcggca
aaaaatggcaatgcaaacaaacgcacattcaaacagagtcccccgagtgctcaaacagtg
ggtgctaatattaagaaaaggaggcacggtgaagatgagatattttatatacctgttcgt
ggtcgggagaattttgaaatcttgatgaaaataaaggaaagtctggaattggtggagctt
gttcctcagcagctggtggattcgtataggcagcaacagcagcagcttcttcagagacaa
acccatatgcagtgtgcttcttcgtatggtcctgccctttcaccaatgaataaacttcat
ggcgggatcaacaagctgccttctgtcaaccaattagtgggacaacctaaccagcataat
tctaatgcagggccaaacttgggaccaatgggtcccggcatgttaaacagtcatcctttg
cagactaatggagagatgaatggggcacattcatctcagtctatggtatcaggatcacat
tgcacccctccaccaccctacagcgcagaccccagcctagtcagttttttgacaggattg
gggtgccccaactgcatcgaatatttcacatcacaagggttacagaatatttaccacctg
cagaaccttactatggaggatcttggggcactgaaaatcccagaacattacaaagcaatg
atatggcgaggcattcaagagcttaacaagagccacgactatggagcccagcagcttgtt
cgatcaagtggcaacggttccagcatttctattggcagctccggtgagctccagcgccag
cgtgttatggaggcagtacatttccgagtacggcacaccatcaccattcccaaccggggc
ggtgctgatgaatgggcagattttggctttgatttacccgactgcaagtcacgcagacag
tccataaaagaggagtacgaaaacagtgatattaactaa

KEGG   Xenopus laevis (African clawed frog): 108697705
Entry
108697705         CDS       T01010                                 

Definition
(RefSeq) tumor protein p73-like
  KO
K10148  tumor protein p73
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108697705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108697705
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    108697705
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 108697705
NCBI-ProteinID: XP_018083482
LinkDB
Position
7S
AA seq 677 aa
MHYNHAEIRLDSCNNTLAKGKYAFLSKVIMEFGVIYPLPESPSVKMSQSTGADEGTTFEH
LWSTLEPDSTYFELPQSSHSNNTEASNRTDVNMDVYQMRSMNESIMSQFNLLNNTMDQSI
GSRAASTSPYNPDHTSNVPTHSPYSQPSSTFEAMSPAPIIPSNTDYPGTHNFEVTFQQSS
TAKSATWTYSPLLKKLYCQIAKTCPIQIKLSNPSPPGSVIRAMPVFKKAEHVTEVVKRCP
NHELGRDFNDGQAAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEPPQVGTECTTILYN
FMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQAAL
NETAAKNGNANKRTFKQSPPSVPTVGSNIKKRRHGEDEIFYIPVRGRENFEILMKIKESL
ELVELVPQQLVDSYRQQQQQLLQRQTHMQSTSSYGPGLSPMNKHHGGINKLPSVNQLVGQ
PNQHNSNAGPNLGPMGPGMLNSHPLQTNGEMNGAHSSQSMVSGSHCTPPPPYSADPSLVS
FLTGLGCPNCIEYFTSQGLQNIYHLQNLTMEDLGALKIPEHYKAVIWRGIQELNKSHDYG
AQQHVRSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIPNRGGADEWADFGFDLPDC
KSHKQSIKEEYENSDIN
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgcattataaccacgctgaaatcaggctagatagttgcaataatacacttgctaaagga
aaatacgcctttctttcaaaagtcatcatggagtttggagtgatataccctttgccggaa
tctccttctgtaaagatgtcccagtctactggagcagatgaagggactacatttgagcac
ctctggagtaccctagagccagacagcacctatttcgaacttccacaatcaagccattca
aacaatactgaagcatctaatcgaacagacgtcaacatggatgtttatcaaatgaggagc
atgaatgaatctatcatgtcccagttcaatctgctgaacaacaccatggatcagagtatc
ggcagcagagcggcctccactagtccctacaaccctgatcatacctcgaatgttcccacg
cattccccctactcacagcccagctccacatttgaggccatgtcacctgctcccatcatc
ccttccaacacagactacccaggaacacacaactttgaggtgacattccagcaatccagt
acagccaagtcagccacatggacgtattctccattgctgaaaaagctgtactgccagata
gctaagacgtgccccatccaaatcaagttatctaatccatcaccgcctggttcagtcatt
cgggcaatgccggtgtttaagaaagcagaacatgtgactgaggttgtgaaacgatgtccc
aatcatgaacttggacgagactttaatgatggtcaagcagcaccagctagccacctcata
cgagtggaaggcaataacttgtctcagtatgtggatgacccagtaacgggtcgacaaagc
gttatggtgccgtatgaaccaccccaggttgggactgagtgcaccacaatactctacaac
ttcatgtgcaacagcagctgcgtgggaggaatgaacaggcggcctattctcatcattatc
acactggaaacaagagatgggcaagtattgggcagaaggtcttttgaaggtcgtatctgt
gcctgtccgggcagagaccgcaaggctgatgaggatcacttccgggagcaagcagcatta
aacgaaacagcagcaaaaaatggcaatgcaaacaaacgcacattcaaacagagtcccccg
agtgtccctacagtgggttccaatattaagaaaaggaggcatggcgaagatgagatattt
tatatacctgttcgtggtcgggagaattttgaaatcttgatgaaaataaaggaaagtttg
gagctggtggagcttgttcctcagcagctggtggattcgtataggcagcaacagcagcag
ctacttcagagacaaacccatatgcagtctacttcttcgtatggccctggtctttcacca
atgaataaacatcatggagggatcaacaagctgccttctgtcaaccaactagtggggcaa
cctaatcagcataattctaatgcagggccaaacctgggaccaatgggacctggaatgtta
aacagtcatcctttgcagactaatggagagatgaatggggctcattcatcccaatctatg
gtatcagggtcacattgtacccctccaccaccctacagtgcagaccccagcttagtcagt
tttttaacaggattggggtgccccaactgcatcgaatatttcacatcacaagggttacag
aatatttaccacctgcagaaccttaccatggaggatcttggagcattgaaaatcccagaa
cattacaaagcggtgatttggagaggcattcaagagcttaacaagagccatgattatgga
gcccagcagcatgttcgatcgagtagtaacgcttccaccatttcgatcggcagctccggt
gagctccagcggcagcgtgtaatggaggcagtacatttccgcgtacggcacaccatcacc
attcccaaccggggcggtgctgatgaatgggcagatttcggctttgatttacctgactgc
aagtcacacaaacagtccattaaagaggagtatgaaaacagtgacattaactaa

DBGET integrated database retrieval system