KEGG   Xenopus laevis (African clawed frog): 108696744
Entry
108696744         CDS       T01010                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04141  Protein processing in endoplasmic reticulum
xla04210  Apoptosis
xla04217  Necroptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108696744
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108696744
   04217 Necroptosis
    108696744
   04115 p53 signaling pathway
    108696744
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108696744
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108696744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xla03029]
    108696744
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    108696744
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    108696744
Transporters [BR:xla02000]
 Other transporters
  Pores ion channels [TC:1]
   108696744
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108696744
NCBI-ProteinID: XP_018081845
LinkDB
Position
7L
AA seq 221 aa
METHGAGGDRPADEKDNKQEEGGAAGGSSLGATGDRSGTVESTEQILETGELLLNGFISD
RLQNNPDVACATSLFPGLSQQTDPSIKRLSECLRKIGDELDANIELQRRIDSVPCTSPKQ
VFFRVAKELFADGIFNWGRVVTLFYFAWKLVVKALCTNVPEMIRTIIDWTMDYLRQYVVQ
WIRDQGGWEGMLSYFGTPTWQTICVFLAGVFTASFVIWRMS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggagacacatggagccggcggggataggcccgcggacgagaaagacaataagcaggag
gaaggcggggctgccgggggttcgagtcttggggctacaggtgaccgtagcggaacagtt
gaatctacagaacagatcctagaaaccggagagcttctgctaaatgggttcatctctgac
cggctgcaaaacaaccctgatgtagcctgtgcaacctctctattccctggcttatcccaa
cagactgacccatctataaagcggcttagtgagtgtctaaggaaaataggcgatgagctg
gatgcaaacatagagctacagaggagaattgatagtgtaccctgcacatcacccaagcag
gtattttttcgtgtggccaaggagctgtttgcagatgggatctttaactggggaagagtt
gttaccctgttctactttgcctggaaacttgttgtaaaggctctttgcacaaacgttcct
gagatgatacgcaccattattgactggaccatggattacctgcggcagtatgttgtccag
tggatacgggatcaaggaggctgggaaggcatgctgtcctactttggcacccctacttgg
caaaccatttgtgtgttcttagctggtgtcttcactgcctcttttgtcatctggaggatg
tcttaa

KEGG   Xenopus laevis (African clawed frog): 373637
Entry
373637            CDS       T01010                                 

Gene name
bax.L, bax, bax-A, xBax, xlbax
Definition
(RefSeq) BCL2-associated X protein L homeolog
  KO
K02159  apoptosis regulator BAX
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04141  Protein processing in endoplasmic reticulum
xla04210  Apoptosis
xla04217  Necroptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    373637 (bax.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    373637 (bax.L)
   04217 Necroptosis
    373637 (bax.L)
   04115 p53 signaling pathway
    373637 (bax.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    373637 (bax.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    373637 (bax.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xla03029]
    373637 (bax.L)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    373637 (bax.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    373637 (bax.L)
Transporters [BR:xla02000]
 Other transporters
  Pores ion channels [TC:1]
   373637 (bax.L)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 373637
NCBI-ProteinID: NP_001079104
Xenbase: XB-GENE-864814
UniProt: Q98U13
LinkDB
Position
7S
AA seq 221 aa
MATHGAGGDCPRDDKEKKQGEGGAAGGSSLGATGDRSGTGISTEQILETGEHLLNGFISD
RLQNNPDVAGARVLFPGISQQSDPSIKRLSECLRKIGDELDANMELQRRIDNVPCTSPKQ
VFFHVAKELFADGVFNWGRVVALFYFACKLVVKALCTKVPEMIRTIINWTMDYLRDYVVQ
WIRDQGGWEGMLSYFGTPTWQTVGVFLAGVLTASLAIWKMS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcgacacatggagccggtggggattgtcccagggatgataaagaaaagaagcaaggg
gaaggcggtgccgccgggggttcgagtctcggggctacaggtgaccgcagcggaacagga
atatccacagaacagatcttagaaacaggagagcatctgctaaatgggttcatctctgac
cggctgcaaaacaatcctgatgtagctggtgcacgggtgctattcccaggcatctcccaa
cagagtgacccgtctataaagcggcttagtgagtgcctgaggaaaataggtgatgagctg
gatgcaaacatggagctacaaaggagaattgataatgtaccctgcacctcacccaagcag
gtattttttcatgtggccaaggaactgtttgccgatggggtcttcaactggggaagagtt
gttgccctattctactttgcctgtaaacttgttgtaaaggctctttgcacaaaagttcct
gagatgattcgcaccatcattaactggaccatggactacctgcgggactatgttgtccag
tggatacgggatcagggaggctgggaaggcatgctgtcctactttggcacccctacttgg
caaacagttggcgtattcctagctggggtcctcactgcctctcttgccatctggaagatg
tcctaa

DBGET integrated database retrieval system