KEGG   Xenopus laevis (African clawed frog): 108696840Help
Entry
108696840         CDS       T01010                                 

Gene name
sdhb.L
Definition
(RefSeq) succinate dehydrogenase complex subunit B, iron sulfur (Ip) L homeolog
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00020  Citrate cycle (TCA cycle)
xla00190  Oxidative phosphorylation
xla01100  Metabolic pathways
xla01200  Carbon metabolism
Module
xla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xla_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108696840 (sdhb.L)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108696840 (sdhb.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108696840 (sdhb.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 108696840
NCBI-ProteinID: XP_018082005
Xenbase: XB-GENE-17339717
UniProt: A0A1L8FP75
LinkDB All DBs
Position
7L
AA seq 301 aa AA seqDB search
MTGRAVLWETGGLSGVKANMAAVVFSLRRSGPVLRLSGALQVSRGAQTAAAPASQAAARI
KKFAIYRWDPDKPGDKPRMQTYEIDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICG
SCAMNINGGNTLACTVRIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKK
KDESQQGKEQYLQSIEDRDKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWM
IDSRDDFTEERLSKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKERAAS
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcgcgcagtattgtgggagactggcggacttagtggtgtcaaagcaaacatg
gcggcggtcgtgttctccttgagacgtagcgggccggtgctcaggttgtcgggagccctg
caggtttctcgtggggcacagacagctgccgctccagcatctcaagcagccgctcgcatc
aagaaatttgccatttacagatgggacccagacaagcccggtgacaaaccccgtatgcag
acgtatgagattgacttgaatacgtgtggccccatggtgttggacgctctgattaagata
aagaacgagatggaccccacactgaccttccgcagatcttgcagagagggtatatgtggc
tcctgcgccatgaacattaacgggggcaacaccctggcctgcactgtgagaatagacacc
aacctgagcaaagtctccaaaatctaccccctccctcacatgtatgttgtaaaggatctt
gtgcctgacctgagtaacttctatgcgcagtacaagtctatagagccgtacctgaagaag
aaggatgagtctcagcaggggaaggagcagtacttacagtccatagaggaccgggataaa
ctggacgggctgtacgagtgcattctgtgtgcctgttgcagtaccagctgccccagctac
tggtggaacgctgataaatatttgggccctgcggtgcttatgcaggcctacagatggatg
attgactccagagatgatttcacagaggagcgactctccaaactacaggaccccttctcc
ctgtaccgctgccacaccatcatgaactgcacccgcacctgccccaagggcctgaacccg
ggcaaagccatcgccgagataaagaagatgatggcgacgtacaaggagagagcggcgtct
gcgtaa

DBGET integrated database retrieval system