KEGG   Xenopus laevis (African clawed frog): 108697809Help
Entry
108697809         CDS       T01010                                 

Gene name
kmt5c.S, SUV420H2
Definition
(RefSeq) lysine (K)-specific methyltransferase 5C S homeolog
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108697809 (kmt5c.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108697809 (kmt5c.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108697809 (kmt5c.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108697809 (kmt5c.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 108697809
NCBI-ProteinID: XP_018083727
Xenbase: XB-GENE-17331705
UniProt: A0A1L8FH81
LinkDB All DBs
Position
7S
AA seq 827 aa AA seqDB search
MGSNRLTARELCENDDLATSLVLDPYLGFRTHKMNVSAMPTIRRQHHLREALQTFHKKKD
PEAAYQSLTAGEWARHYFHSRSRQQESLLKAHIFRYLRMFLPESGFMILSCSRYSLETNG
AKVVSTKSWSKNEKIELLVGCIAELSKADETLLRFGDNDFSVMYSTRKKCAQLWLGPAAF
INHDCRPNCKFVPTDGNAACVKVLREIKSGEEITCFYGDSFFGEKNEQCECCTCERKGEG
AFKQQKTEQTVSTSLEKYQLRETDGRLKRLRESACKQSHQVTTKKKKRPQGSKVRLALRL
RRIPPSRRKRVFYRRLRTLASSHFYSSSLAKHISFKPVKIALPRGTVLRDVRIILHNCKR
CNMASRSKSQHEGKCCKLGKVPLVSILREDLSPEKLKFRLICPPTIQTANIECNAKDRSL
PEAGSINMEPITTAEVCEHVSFSPLPSHNGDEDSFYEPEIPGSLLGPESPSSVLESGSED
GLSGPNNDEPISNNLNMECPPLEPIVKDTVYPYDGSKMSVSHLHALKQFGITRYIKVDLR
KHVDLQSEKSQPDKSSSAANRKLNPNHIHSHQPLRSDDHLLANLNAKAQNKVVLRKDVAL
ESEKPRPDKSSSATNRKPNLNHIHSQLPIRSDDHLPANFNTEAQNNTVVSPTAKTPISEA
LNGSPDRKVSSLRSRSVTFRETSDNKITLFKRRRSSVKPGVQCVKLNGHVKLTGQIVYSK
LDPPTKAVAKHLTHTMHSDPKLLLKPYVQLGINNNLKRSSFTGLAHSKVLTEEAVKLHNP
PASKPSTVGAKKNVAFNPFTPSKRLRLVVSLGSIALDMASTSSEETN
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaatcggttgacggcaagagaactgtgtgagaatgatgacctcgcgactagt
ttggtgcttgacccttacctggggtttaggactcacaaaatgaatgtcagcgctatgccc
acgataagaaggcagcatcacctgagagaggctctgcaaacattccataagaaaaaggac
ccagaagctgcgtatcagtcactaacagcaggagaatgggctcgtcattacttccacagc
cgttcccgacaacaagagagtcttctcaaggcacatatattccgatatctccggatgttt
cttccagagagtgggttcatgattctttcctgtagtcggtactctctagaaaccaacggc
gcaaaagttgtctccacgaaatcatggtcaaagaatgaaaagatcgaactcctggtggga
tgcattgctgaactaagcaaagcagatgagaccctccttcgctttggagataatgatttt
agcgtcatgtactccactcggaaaaagtgtgcacagctctggttagggcctgctgccttt
atcaaccacgactgtcggccaaactgcaagtttgtaccaacagatggaaacgccgcgtgc
gtaaaggttctcagggaaatcaaatccggtgaagagatcacatgcttctacggagatagc
ttttttggagagaaaaatgaacagtgtgaatgttgcacttgtgaaagaaaaggggagggt
gcttttaagcagcaaaaaacagagcagacagtatctacctcattagaaaaataccagctc
cgtgagacagatggtcgtttgaagagactccgcgagagtgcctgcaaacaatcccatcaa
gtaactacaaagaaaaagaagcgtccacagggttcaaaagttagactagcgctcagactg
agaaggattccaccatcccgaagaaagagagttttctatcgaagactacggactcttgct
tcctctcatttttattcatctagcctagctaagcacatttccttcaagcctgtgaagatt
gcactgccccggggtactgttttaagggacgtgcgtatcattttgcataactgcaaaaga
tgtaacatggcttcccgctctaaaagccagcatgaggggaaatgctgtaaactaggaaag
gtacctttggtgtccattctccgggaagacctcagtcctgaaaagctaaaatttagacta
atctgccctcccaccattcagacagctaatatagagtgcaatgccaaagatcgctctttg
cctgaagcaggaagcatcaacatggagccaatcacaacagccgaagtgtgtgaacacgtg
tctttctcccctctgccgagtcacaacggagatgaagactctttctatgagcccgaaatc
cccggatcattgttggggcctgaaagtccatcttctgttcttgaaagcggttcagaagat
ggactttcaggccccaacaacgatgaacccatttccaacaacttaaacatggaatgtcct
cctcttgagcctattgttaaagacaccgtgtatccttatgatggcagtaaaatgtcagtg
tcgcatcttcatgcacttaaacagtttgggataacacgttatattaaagtcgatctgagg
aaacatgtcgatttacaatccgaaaagtctcagcctgataaaagttcatcggcagcaaat
aggaaactgaatcctaatcatattcattctcatcaacctcttcgttcagacgaccacctt
ctggctaatttgaatgccaaagcacagaataaagtcgtactaagaaaagacgtcgcttta
gaatctgaaaagcctcggcctgataaaagttcatcggcaacaaataggaaaccaaacctt
aatcatattcattctcaactccctattcgttcagacgaccaccttccggctaatttcaat
accgaagcacagaataacaccgtagtaagcccaactgcaaagacgccaataagcgaagcc
ttaaacgggtcaccagatcgtaaagtttcctctttaagatccagatcggtaacatttaga
gagacttcagacaacaagatcaccctatttaaaaggagacgcagttctgttaagccaggg
gtacaatgtgtaaaactgaacggacatgttaaattgacaggtcagattgtttatagtaaa
ctcgatccgcccactaaggctgtagccaagcacctcactcacacaatgcactctgaccct
aaactgttgctaaagccatacgtccagttgggaatcaacaacaatttaaagaggtcgtca
tttactggactagcccacagcaaggttttaacagaggaagccgttaaattacacaacccc
ccggcatcaaagccgtcgacggtaggcgcaaagaaaaatgtggcgtttaacccattcacc
ccctccaaaagactgcggctggtggtcagccttgggtctattgctctagacatggcatcc
acgtcgagtgaagaaaccaattaa

DBGET integrated database retrieval system