KEGG   Xenopus laevis (African clawed frog): 108697837
Entry
108697837         CDS       T01010                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108697837
   04340 Hedgehog signaling pathway
    108697837
   04371 Apelin signaling pathway
    108697837
   04068 FoxO signaling pathway
    108697837
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108697837
   04115 p53 signaling pathway
    108697837
   04218 Cellular senescence
    108697837
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108697837
   04530 Tight junction
    108697837
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 108697837
NCBI-ProteinID: XP_018083765
LinkDB
Position
7S
AA seq 252 aa
MQSPNVQILCCSFLWLQLEFHQCLFLPQVCEEQKCGEDVFPLAVNCLDRFLSLVPVEKRH
LQLLGSTCLFLASKLRDSTPMTAESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPR
QFLPHFLELLVIPTEKRPRVRKLAETFITLCSTDCTFITLPPSMVAAACVAAAVTGLQLQ
SSGMSYSSVATVTFLAHAIRCEPSLLRTCQEQIEISLESSLQQAQRNRISESKSVEEPER
SSTPTDVLDIDL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcaatccccaaatgtgcagattctctgctgttcattcctttggctgcagctcgagttc
caccagtgtttgttccttcctcaggtgtgtgaagagcagaaatgcggagaagacgtcttc
cccctggctgtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacat
ctccagcttttgggctcaacgtgcctctttcttgcctctaaactcagggactccactccc
atgactgccgagagcctgtgcatgtactcagactactgtttcactgacaaagaactgctg
gcaatggagctgctggtgctgaacaagctgaaatgggacatagaagcggtgacaccccga
cagttcctgccgcacttcctcgaactgttggttatccctacggagaagaggcctcgggtc
aggaagctcgcggagaccttcatcactctgtgtagcactgactgtacatttattaccctc
cccccttccatggtggctgcagcctgtgtagccgcagcagtgaccggcctccagcttcag
agttcgggaatgagctactccagcgtggctaccgtaaccttccttgcacatgccatacgc
tgtgagccgagtcttctcaggacttgtcaggagcagattgaaatctcgcttgagtccagt
ctgcagcaggcgcagagaaacagaatctccgagtccaagtctgtggaggagccagagaga
tccagcaccccaactgatgtcctggacattgacctgtaa

DBGET integrated database retrieval system