KEGG   Xenopus laevis (African clawed frog): 108697837
Entry
108697837         CDS       T01010                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108697837
   04340 Hedgehog signaling pathway
    108697837
   04371 Apelin signaling pathway
    108697837
   04068 FoxO signaling pathway
    108697837
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108697837
   04115 p53 signaling pathway
    108697837
   04218 Cellular senescence
    108697837
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108697837
   04530 Tight junction
    108697837
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 108697837
NCBI-ProteinID: XP_018083765
LinkDB
Position
7S
AA seq 252 aa
MQSPNVQILCCSFLWLQLEFHQCLFLPQVCEEQKCGEDVFPLAVNCLDRFLSLVPVEKRH
LQLLGSTCLFLASKLRDSTPMTAESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPR
QFLPHFLELLVIPTEKRPRVRKLAETFITLCSTDCTFITLPPSMVAAACVAAAVTGLQLQ
SSGMSYSSVATVTFLAHAIRCEPSLLRTCQEQIEISLESSLQQAQRNRISESKSVEEPER
SSTPTDVLDIDL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcaatccccaaatgtgcagattctctgctgttcattcctttggctgcagctcgagttc
caccagtgtttgttccttcctcaggtgtgtgaagagcagaaatgcggagaagacgtcttc
cccctggctgtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacat
ctccagcttttgggctcaacgtgcctctttcttgcctctaaactcagggactccactccc
atgactgccgagagcctgtgcatgtactcagactactgtttcactgacaaagaactgctg
gcaatggagctgctggtgctgaacaagctgaaatgggacatagaagcggtgacaccccga
cagttcctgccgcacttcctcgaactgttggttatccctacggagaagaggcctcgggtc
aggaagctcgcggagaccttcatcactctgtgtagcactgactgtacatttattaccctc
cccccttccatggtggctgcagcctgtgtagccgcagcagtgaccggcctccagcttcag
agttcgggaatgagctactccagcgtggctaccgtaaccttccttgcacatgccatacgc
tgtgagccgagtcttctcaggacttgtcaggagcagattgaaatctcgcttgagtccagt
ctgcagcaggcgcagagaaacagaatctccgagtccaagtctgtggaggagccagagaga
tccagcaccccaactgatgtcctggacattgacctgtaa

KEGG   Xenopus laevis (African clawed frog): 373667
Entry
373667            CDS       T01010                                 

Gene name
ccnd2.L, ccnd2, ccnd2-a, ccnd2-b
Definition
(RefSeq) cyclin D2 L homeolog
  KO
K10151  G1/S-specific cyclin-D2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    373667 (ccnd2.L)
   04340 Hedgehog signaling pathway
    373667 (ccnd2.L)
   04068 FoxO signaling pathway
    373667 (ccnd2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    373667 (ccnd2.L)
   04115 p53 signaling pathway
    373667 (ccnd2.L)
   04218 Cellular senescence
    373667 (ccnd2.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    373667 (ccnd2.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 373667
NCBI-ProteinID: NP_001079130
Xenbase: XB-GENE-6252872
UniProt: P53782 B7ZQ67
LinkDB
Position
3L
AA seq 291 aa
MELLCCEGDTVRRAQPDPALLLDDRVLHNLLTVEERYLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQRCEEEVFPMAMNYLDRFLAVIPTRKCHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPLPKDKLLLIRKH
AQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDVGETSLSGDSLTEHLAKITSTDV
DCLKACQEQIESVLVSSLRQTRQQTQQRNSSKSVDELDQASTPTDVQDINL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaactgctgtgctgcgagggggacactgtccgcagggctcagcctgacccggcgctg
ctgctggatgacagggtcctgcacaatctgctcaccgtggaggagaggtacctgccccag
tgctcctacttcaaatgtgtccagaaggacatccagcccttcatgaggaggatggtggcc
acatggatgctggaggtttgcgaagaacagaggtgcgaggaagaagtgttccccatggcc
atgaattatttggatagatttttagcagtgatccccaccagaaagtgccatttacaactc
cttggagctgtctgcatgttcttagcttccaagctgaaagagactatccctttaactgca
gagaaactttgcatttatactgacaattctatcaaaccacaagagctgctggagtgggag
ctggtggttctggggaagttgaagtggaacctggccgctgtgacgccacacgatttcata
gaacacatactaagaaagttgcccttgcctaaagacaaattactcttgatccggaaacat
gcacaaacattcattgctctttgtgctacagactttaactttgcaatgtacccaccatct
atgatagcaactggaagtgtaggagcggcgatatgtgggctgcagttggatgttggagaa
acctctctttctggcgatagtctcacagagcatttggccaagatcactagcacagatgtg
gattgccttaaagcttgtcaagagcagattgagtcggtgctggtgagcagcctcagacag
accaggcagcagacacagcaaagaaactcgtccaagtctgtggatgaactggaccaggct
agcactcctacagatgtgcaggacatcaacctgtga

KEGG   Xenopus laevis (African clawed frog): 379161
Entry
379161            CDS       T01010                                 

Gene name
ccnd1.S, ccnd1, ccnd1-a, ccnd1-b, ccnd1b, cyclind1, prad1
Definition
(RefSeq) cyclin D1 S homeolog
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    379161 (ccnd1.S)
   04340 Hedgehog signaling pathway
    379161 (ccnd1.S)
   04371 Apelin signaling pathway
    379161 (ccnd1.S)
   04068 FoxO signaling pathway
    379161 (ccnd1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379161 (ccnd1.S)
   04115 p53 signaling pathway
    379161 (ccnd1.S)
   04218 Cellular senescence
    379161 (ccnd1.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    379161 (ccnd1.S)
   04530 Tight junction
    379161 (ccnd1.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 379161
NCBI-ProteinID: NP_001079474
Xenbase: XB-GENE-6251625
UniProt: Q7ZYJ6
LinkDB
Position
4S
AA seq 291 aa
MELLCCEVDTIRRAHLDRNLITDRVLQTMLKAEETSCPSVSYFKCVQKEVLPNMRKIVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPLRKSRLQLLGATCMFLASKMKETIPLTAE
KLCIYTDNSIRPDELLLMELLILNKLKWDLASVTPHDFIEHFLNKMPLTEDTKQIIRKHA
QTFVALCATDVKFISNPPSMIAAGSVAAAVQGLNLGNADGVFSTQRLTLFLSQVIKCDPD
CLRACQEQIESLLESSLRQAQQQHNTSSDTKNMEEEVDISCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagcttttgtgctgcgaggtggacaccatcaggagggcccatctggacaggaacctc
atcacggaccgggtgctgcagacaatgctcaaagcagaggagacctcctgccccagcgtg
tcctatttcaagtgcgtccagaaggaggtcctgcccaacatgcgcaaaatagtggccacc
tggatgctggaggtgtgcgaggagcagaagtgcgaagaggaagttttcccccttgctatg
aactatttggaccgattcctgtccgtggagcccctccggaagagccgactgcagttgctg
ggggccacttgtatgtttttggcttctaaaatgaaggaaacgatcccactgaccgcagag
aagctttgcatttacacggacaattccatcaggccagacgagttactgctaatggaactg
ctgattttgaacaaactgaaatgggacttggcatctgtgaccccccatgactttattgaa
cattttctaaacaaaatgccactgactgaggataccaagcagatcatccgcaaacacgcc
cagacatttgttgccctctgcgctacagatgtaaagtttatctccaatccaccctccatg
atcgccgccggcagtgttgcagcagctgttcagggactaaatttgggaaacgcagatggt
gtcttctccacccaacgcctcacacttttcctatcacaggtcatcaaatgtgacccggac
tgtttacgggcgtgccaagaacagattgagtccctcctagagtccagtttgcgccaagca
cagcagcaacacaacacttcctcagacacaaaaaacatggaagaagaggtggatatctcc
tgcaccccgaccgatgtccgagacgtcaatatctga

KEGG   Xenopus laevis (African clawed frog): 379937
Entry
379937            CDS       T01010                                 

Gene name
ccnd1.L, ccnd1, ccnd1-a, ccnd1-b, ccnd1a, cyclind1, prad1
Definition
(RefSeq) cyclin D1 L homeolog
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    379937 (ccnd1.L)
   04340 Hedgehog signaling pathway
    379937 (ccnd1.L)
   04371 Apelin signaling pathway
    379937 (ccnd1.L)
   04068 FoxO signaling pathway
    379937 (ccnd1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379937 (ccnd1.L)
   04115 p53 signaling pathway
    379937 (ccnd1.L)
   04218 Cellular senescence
    379937 (ccnd1.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    379937 (ccnd1.L)
   04530 Tight junction
    379937 (ccnd1.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 379937
NCBI-ProteinID: NP_001080245
Xenbase: XB-GENE-6077366
UniProt: Q8AVQ4
LinkDB
Position
4L
AA seq 291 aa
MELLCCEVDTIRRAHLDRNLITDRVLQTMLKAEETSCPSMSYFKCVQKEILPNMRKIVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPLRKSWLQLLGATCMFLASKMKETIPLTAE
KLCIYTDNSIRPDELLIMELRVLNKLKWDLASVTPHDFIEHFLNKMPLTEDTKQIIRKHA
QTFVALCATDVNFISNPPSMIAAGSVAAAVQGLNLGNADSVFSTQRLTLFLSQVIKCDPD
CLRACQEQIESLLESSLRQAQQQHNASSDTKNMVDEVDISCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagcttctatgctgcgaagtggacaccatcaggagggcccatctggacaggaacctc
atcaccgaccgggtgctgcagaccatgctcaaagcagaggagacctcctgccccagcatg
tcttatttcaagtgcgtccagaaggagatcctgcccaacatgcgcaaaatagtggccacc
tggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccctcgctatg
aactatttggaccgattcctgtccgtggagcccctccggaagagctggttgcagttgctg
ggggccacttgtatgttcctggcttctaaaatgaaggaaaccatcccactgaccgcagag
aaactttgcatttacaccgacaattccatcaggccagacgagttactgataatggaactg
cgggttctgaacaaactgaaatgggacttggcatctgtgaccccccatgactttattgaa
cattttctaaacaaaatgccactgactgaggataccaagcagatcatccgcaaacacgcc
cagacatttgttgccctctgcgctacagatgtaaattttatctccaatccaccctccatg
atcgccgctggcagtgtcgcagcagctgttcagggactaaatttgggaaacgccgacagt
gtcttctccacccaacgcctcacacttttcctatcacaggtcatcaaatgcgacccggac
tgtttacgggcatgtcaagaacagattgagtcccttctagagtccagtttgcgccaagca
cagcagcaacacaacgcttcatcagacacaaaaaacatggtggatgaagtggacatctcc
tgcaccccgaccgatgtccgagacgtcaacatctga

KEGG   Xenopus laevis (African clawed frog): 447541
Entry
447541            CDS       T01010                                 

Definition
(RefSeq) MGC83948 protein
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    447541
   04340 Hedgehog signaling pathway
    447541
   04371 Apelin signaling pathway
    447541
   04068 FoxO signaling pathway
    447541
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    447541
   04115 p53 signaling pathway
    447541
   04218 Cellular senescence
    447541
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    447541
   04530 Tight junction
    447541
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 447541
NCBI-ProteinID: NP_001087717
UniProt: Q66IZ3
LinkDB
Position
Un
AA seq 289 aa
MEGNVLRWETELKAQEEPVLLQSRVLMNLLLELEERHIPCISYFHCVQTRLQPYMRRMLT
SWMLEVCEEQKCGEDVFPLAVNCLDRFLSLVPVEKRHLQLLGSTCLFLASKLRDSTPMTA
ESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPRQFLPHFLELLVIPTEKRPRVRKL
AETFITLCSTDCTFITLPPSMVAAACVAAAVTGLQLQSSGMSYSSVATVTFLAHAIRCEP
SLLRTCQEQIEISLESSLQEAQRNRISESKSVEEPERSSTPTDVLDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagggaaatgtgctgcgctgggagacggagctgaaggcccaggaggagccggtgctg
ctgcagagccgagtgttgatgaatctgctgctggaattagaggagagacacatcccgtgt
atttcctacttccactgtgtccagactcggctccagccctacatgcggcgcatgctcact
agctggatgctcgaggtgtgtgaagagcagaaatgcggagaagacgtcttccccctggct
gtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacatctccagctt
ttgggctcaacgtgcctctttcttgcctctaaactcagggactccactcccatgactgcc
gagagcctgtgcatgtactcagactactgtttcactgacaaagaactgctggcaatggag
ctgctggtgctgaacaagctgaaatgggacatagaagcggtgacaccccgacagttcctg
ccgcacttcctcgaactgttggttatccctacggagaagaggcctcgggtcaggaagctg
gcggagaccttcatcactctgtgtagcactgactgtacatttattaccctccccccttcc
atggtggctgcagcctgtgtagccgcagcagtgaccggcctccagcttcagagttcggga
atgagctactccagcgtggctaccgtaaccttccttgcacatgccatacgctgtgagccg
agtcttctcaggacttgtcaggagcagattgaaatctcgcttgagtccagtctgcaggag
gcgcagagaaacagaatctccgagtccaagtctgtggaggagccagagagatccagcacc
ccaactgatgtcctggacattgacctgtaa

KEGG   Xenopus laevis (African clawed frog): 447748
Entry
447748            CDS       T01010                                 

Gene name
ccndx.L, ccndx, ccndx.S
Definition
(RefSeq) cyclin Dx L homeolog
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    447748 (ccndx.L)
   04340 Hedgehog signaling pathway
    447748 (ccndx.L)
   04371 Apelin signaling pathway
    447748 (ccndx.L)
   04068 FoxO signaling pathway
    447748 (ccndx.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    447748 (ccndx.L)
   04115 p53 signaling pathway
    447748 (ccndx.L)
   04218 Cellular senescence
    447748 (ccndx.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    447748 (ccndx.L)
   04530 Tight junction
    447748 (ccndx.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 447748
NCBI-ProteinID: NP_001087887
Xenbase: XB-GENE-6077523
UniProt: Q641B3
LinkDB
Position
7L
AA seq 290 aa
MEGNLLCWEPETELRAQSDPVLLQSRVLMKLLELEERYIPSASYFYCVQTHLQPYMRRML
TSWMLEVCEDQKCGEDVFPLAVNCLDRFLSLVPVEKRRLQLLGSTCLFLASKLRETTPMT
AESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPREFLPHFLELLGLPTEKRRQVRK
HSETFIALCTTDCTFIALPPSMVAAASVVAAVTGLQLQSPGMSNSSVATITYLAHAIRCD
PSLLRTCQEQIEMSLESSLQQAQRNRISESKSVDEPERSSTPTDVLDIDL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagggaaatctgctgtgctgggagcccgagacagagctgagggcccagtccgacccg
gtgttgctgcagagccgagtgctgatgaagctgctggaattagaggagagatacatcccg
tctgcttcttacttctactgtgtccagactcacctgcagccctacatgcggcgcatgctc
actagctggatgctcgaggtgtgtgaagaccagaagtgcggagaagacgtgttccctctg
gctgtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacgactgcag
cttctgggctcaacgtgcctctttcttgcctccaaactgagggaaaccacccccatgact
gccgagagcctgtgcatgtactccgactactgtttcactgacaaagaactgctggcaatg
gagctgctggtgctgaacaagctgaagtgggacatagaagcggtgaccccccgggagttc
ctgccgcactttttggaactgttgggtctccctacggagaagagacgtcaggtcaggaag
cactcggagaccttcattgctctgtgcaccaccgactgtacatttattgcactcccccct
tccatggtggctgcagccagtgtagtcgcagcagtgaccggcctccagcttcaaagtcca
ggaatgagcaactccagcgtggctaccataacctaccttgcacatgccatccgctgtgac
ccgagtcttctcagaacttgtcaggagcagattgaaatgtcacttgagtccagtctgcag
caggcgcagaggaacaggatctccgagtccaaatctgtggatgagccagagagatccagc
accccgactgatgtcctggacattgacttgtaa

KEGG   Xenopus laevis (African clawed frog): 734882
Entry
734882            CDS       T01010                                 

Gene name
ccnd2.S, ccnd2, ccnd2-a, ccnd2-b
Definition
(RefSeq) cyclin D2 S homeolog
  KO
K10151  G1/S-specific cyclin-D2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    734882 (ccnd2.S)
   04340 Hedgehog signaling pathway
    734882 (ccnd2.S)
   04068 FoxO signaling pathway
    734882 (ccnd2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    734882 (ccnd2.S)
   04115 p53 signaling pathway
    734882 (ccnd2.S)
   04218 Cellular senescence
    734882 (ccnd2.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    734882 (ccnd2.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 734882
NCBI-ProteinID: NP_001089817
Xenbase: XB-GENE-865455
UniProt: Q3KPK0
LinkDB
Position
3S
AA seq 291 aa
MELLCCEGDTVRRAQLDPALLLDDRVLHNLLTVEERYLPHCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQRCEEEVFPLAMNYLDRFLAVIPTRKSHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPLPKDKLLLIRKH
AQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDDGETSLSGDSLTEHLAKITSTDV
DCLKACQEQIESVLVRSLRQTRQQAQQRNSSKSVDELDQASTPTDVQDINL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaactgctgtgctgcgagggggacactgtccgcagggctcagcttgaccccgcgctg
ctgctggatgacagggtcctgcacaatctgctcaccgtggaggagaggtacctgccccac
tgctcctacttcaaatgtgtccagaaggacatccagcccttcatgaggaggatggtggcc
acttggatgctggaggtctgtgaagaacagaggtgcgaggaagaagtgttccccctggcc
atgaattacttggatagatttttagctgtgatcccaacaagaaagagccatttacaactc
ctcggggccgtctgcatgttcttagcttccaagctgaaagagactatccctttaaccgca
gagaaactttgcatttatactgacaattctatcaaaccgcaagagctgctggagtgggag
ctggtggttctgggaaagttgaagtggaacctggctgcggtgacgccacatgatttcata
gaacacatactaagaaaattgcccttgccaaaagacaaattgctcttgatccggaaacat
gcacaaacgttcattgcactttgtgccacagactttaactttgcaatgtacccgccatct
atgatagcaactggaagtgtaggagcagcgatatgtgggctgcagttggatgatggagaa
acctctctttctggcgatagtctcacagagcatttggccaagatcactagcacagatgtg
gattgccttaaagcttgtcaggagcagatcgagtcggtgctggtgagaagcctcagacag
acgaggcaacaggcacagcaaagaaactcgtccaagtccgtggatgaactggaccaggct
agcactcctacagatgtgcaggacatcaacctgtga

DBGET integrated database retrieval system