KEGG   Xenopus laevis (African clawed frog): 108698555
Entry
108698555         CDS       T01010                                 

Gene name
atf6b.L, crebl1
Definition
(RefSeq) activating transcription factor 6 beta L homeolog
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04141  Protein processing in endoplasmic reticulum
xla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108698555 (atf6b.L)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108698555 (atf6b.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108698555 (atf6b.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108698555 (atf6b.L)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 FlaC_arch bZIP_Maf DUF3450 YabA DUF4407 GAS Yuri_gagarin CENP-H
Other DBs
NCBI-GeneID: 108698555
NCBI-ProteinID: XP_018085625
Xenbase: XB-GENE-6489170
UniProt: A0A1L8F8F1
LinkDB
Position
8L
AA seq 610 aa
MGTELLLNDLDTKFCADNLLTSEDWETGLYSYLDEADENVELFNHYPLQLFDSRMDVDTC
SMSSSWEEIHSKNLSGLLVKTEPVSPFSSSSSCDSSSSCDALYTQSLGDIETAVKVELPP
SPPCQSHDSSRSQCSALQITLLPVHTGTSQSGCLSKANTLLSKKPPLQPRPAPGSKPHPP
SNNSTPHTIILHPLTSTPPAASPPVLVSQLLPVQNGGTGTPPIKPEAKSIVPAPCASKNN
PAEVDPKLLKRQQRMIKNRESACQSRRKKKEYVQGLEARLQETERQLENARRENRELRET
VQHLMKENASLRVSSGRKVVCVMVVLVFVAFNFGPTSLFSGILEEPGRNPEISRHTRHLL
TYQSEEDVSKSSGPKYYASRPPASVGKFSNGSLTNVKHLLVRDLDQLFLTSDCRHFNHTE
SLRLADELRLWVRRHQNERKSGKQVKKPRRVKKPLIRKAISLSDLVPAQPSRVTHRLHSA
PLQLYNPSEPSDTFLTDAIERREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMSV
NDSVYNTTRGYETMMQIDCEVMDTRVIQIKSSTVPPSLRTSPSPPAQKETPHGNLSLYLQ
DHTPSDDGQN
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgggaacagagcttttgctgaatgacttggatacaaaattctgtgccgacaatctactg
accagcgaagattgggaaacagggctttatagttacctagatgaagcagatgagaatgtc
gagctgtttaaccactatcctcttcagctgtttgacagtcgcatggatgttgacacctgt
tccatgtcatcttcctgggaggagatccacagtaagaatttatcaggtctcctagtaaaa
actgaaccagtatcaccattctcctcttcgtcttcctgtgattcttcatcctcctgtgat
gccctctatacacaatctctgggggatattgagactgccgtaaaggttgagcttccccca
tcgcctccctgtcaaagccacgattcttctcgttcccagtgcagtgctttgcaaataact
cttcttccagtgcatacgggcacaagtcagtctggatgtctttctaaggctaacaccctt
ttgtcaaagaagccacctttgcagcccagacctgctcctgggtctaaacctcatcctcct
tcaaacaacagcacaccacacaccatcatattacaccctttgacaagcactcctcctgca
gcttcaccaccagtacttgtttcccagctccttcctgtacagaatggaggaacaggaacc
ccaccaattaaaccagaagccaagtccattgtgccggccccctgtgccagtaaaaacaac
cctgctgaggtggatcccaaacttttaaagagacagcagcgaatgatcaagaacagggaa
tcagcatgtcagtctcgtcgaaagaagaaagagtatgtgcaggggctggaggcaagactg
caagagacggagaggcagctggagaatgcccgtcgtgagaacagggaacttagggagaca
gtgcagcatctaatgaaagagaatgcatccctccgtgtctcctctggcagaaaggttgtc
tgtgttatggttgtccttgtgtttgttgccttcaactttgggcctacaagcttgtttagt
ggtatactggaggaaccagggaggaatcctgaaatttcccgtcatacccgtcatttacta
acataccagagtgaagaggatgtatctaagtcttctggacctaagtactatgcatcacgt
ccaccagcctctgtaggaaagttcagtaatggttccctgacaaatgtaaaacaccttctt
gtcagagatcttgatcagctttttcttacatcagattgcaggcattttaatcacacagaa
tctctcaggttagctgatgaactccgattatgggttcgccgccatcaaaatgaaagaaag
agtggaaagcaagtcaaaaagccaagaagagtgaagaagccccttataagaaaagctatt
tctctgtcagacctagtacctgctcaaccctccagagtcacacataggttacacagtgct
ccgctgcagctctacaacccgtcagagccaagtgatacttttctcacggatgccatcgaa
agacgagaggatactttctatgttgtgtccttccgcagggatcaccttctccttcctgct
ataagtcacaataaaacatcccgtcccaaaatgtcccttgtaatgccagccatgtcagtg
aatgacagtgtatataacaccacccgtggatatgaaacaatgatgcagatagattgtgaa
gttatggacactcgagttatccaaatcaaatcgtccactgtgcccccttccctgcgcaca
tcaccttctccacctgcccaaaaggagactccccatgggaacctctcactttatcttcag
gatcatactccgtcagatgatggtcagaactga

DBGET integrated database retrieval system