KEGG   Xenopus laevis (African clawed frog): 108698803
Entry
108698803         CDS       T01010                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108698803
   04012 ErbB signaling pathway
    108698803
   04370 VEGF signaling pathway
    108698803
   04371 Apelin signaling pathway
    108698803
   04068 FoxO signaling pathway
    108698803
   04150 mTOR signaling pathway
    108698803
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108698803
  09143 Cell growth and death
   04210 Apoptosis
    108698803
   04218 Cellular senescence
    108698803
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108698803
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108698803
   04625 C-type lectin receptor signaling pathway
    108698803
  09152 Endocrine system
   04910 Insulin signaling pathway
    108698803
   04920 Adipocytokine signaling pathway
    108698803
   04914 Progesterone-mediated oocyte maturation
    108698803
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108698803
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108698803
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108698803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108698803
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108698803
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   108698803
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 108698803
NCBI-ProteinID: XP_018086106
LinkDB
Position
8L
AA seq 481 aa
MNDISIVKEGWLHKRGEYIKTWRPRYFLLKTDGTFIGYKERPQDVDQLETPLNNFSVAKC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREEWIQVIQHVADNLKKQEEEMMDV
RSGDSPSDNSGAEEMEISHSKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLLPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEK
KLIPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNLEFVDNERRPHFPQFSYSASGN
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgatataagcattgtgaaggaaggctggctacacaaaagaggtgaatacataaag
acctggcgcccccgctactttctcctcaaaactgacggtactttcattgggtacaaagag
cgtccacaggatgttgaccagttggaaactcctttaaataatttctctgtagccaaatgt
cagctgatgaagacagaacgaccaaaaccaaacacatttatcattcggtgcctccagtgg
accacagtaattgaaagaacatttcatgtggattctccagaggagcgggaagaatggatt
caggtcatacaacatgtagccgacaaccttaagaaacaggaagaagaaatgatggatgtt
cggtccggcgactctccaagcgataactctggagctgaggaaatggaaatttctcattca
aaaccaaaacataaagttacaatgaatgaatttgagtatctgaagcttttggggaaagga
acgtttgggaaagttattctagtgaaagagaaagcaacaggaagatactacgctatgaaa
attttaaaaaaagaagttattgttgcaaaggatgaagtagcccacacgctaacagaaaac
cgcgtcctgcagaattctaggcatcccttcctaacagcattgaaatattcctttcagaca
catgatcgcttatgttttgtgatggagtatgccaacggaggagagttattcttccactta
tcaagagaacgtatattctctgaagatcgtgcccggttttatggggctgagattgtttct
gctttagattatcttcattctgagaaaaatgtagtttacagagatttaaagttggaaaat
ctaatgctggacaaagatggacacataaagataacagattttggcctgtgcaaagaagga
ataaaagatggagcaaccatgaagacgttctgtggaacaccagaatatcttgctcccgag
gtgctagaagataatgactatggtcgtgctgtagactggtggggcttgggcgtagtgatg
tacgagatgatgtgtgggcgcctccctttttacaaccaagaccatgaaaaattgtttgaa
cttatccttatggaagaaattcgattcccacgcactttattgccagaagcaaagtctttg
ctgtctggtttgttgaagaaggaccctaagcaaaggttaggtggcgggccagacgatgca
aaagaaatcatgcaacacaaattttttgctggaattgtatggcaagatgtttacgagaag
aagcttatacccccatttaagccacaagtaacgtcagaaacagacacaaggtattttgat
gaagaattcacagcgcaaatgatcaccataacaccgcctgaccaagatgataatttagaa
tttgtggacaacgagagaagacctcacttcccccagttttcatactccgctagtggaaat
gcttag

KEGG   Xenopus laevis (African clawed frog): 379783
Entry
379783            CDS       T01010                                 

Gene name
akt2.L, akt2, akt2-a, pkbb, pkbbeta, pkbss, prkbb, rac-beta, v-akt2
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 2 L homeolog
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    379783 (akt2.L)
   04012 ErbB signaling pathway
    379783 (akt2.L)
   04370 VEGF signaling pathway
    379783 (akt2.L)
   04371 Apelin signaling pathway
    379783 (akt2.L)
   04068 FoxO signaling pathway
    379783 (akt2.L)
   04150 mTOR signaling pathway
    379783 (akt2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    379783 (akt2.L)
  09143 Cell growth and death
   04210 Apoptosis
    379783 (akt2.L)
   04218 Cellular senescence
    379783 (akt2.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    379783 (akt2.L)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    379783 (akt2.L)
   04625 C-type lectin receptor signaling pathway
    379783 (akt2.L)
  09152 Endocrine system
   04910 Insulin signaling pathway
    379783 (akt2.L)
   04920 Adipocytokine signaling pathway
    379783 (akt2.L)
   04914 Progesterone-mediated oocyte maturation
    379783 (akt2.L)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    379783 (akt2.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    379783 (akt2.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    379783 (akt2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    379783 (akt2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     379783 (akt2.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   379783 (akt2.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 379783
NCBI-ProteinID: NP_001080091
Xenbase: XB-GENE-484172
UniProt: Q7ZX15 A0A1L8F8Y4
LinkDB
Position
8L
AA seq 486 aa
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHNVVLPPLNNFSVA
ECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDE
EEEAMEVKYGSPSDVSSAEQMDVAMSKGHPKVTMNDFDYLKLLGKGTFGKVILVREKATG
RYYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGG
ELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFG
LCKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDH
ERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFVSINWQ
DVTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSY
SASIRE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatattaaa
acatggagaccacgatatttccttctgaaaagtgatggttcctttattggctataaagag
aagccagagtccacagagcacaatgtggtgcttccacccctcaataacttctctgttgca
gaatgtcagctaatgaagacagaacggcctaggcccaacacatttgtgattcggtgccta
caatggactaccgttattgaacggacttttcatgttgacacacctgaggaaagggaagaa
tggattattgccatccagacagtggccaatggcctgaagaaccaggtgcccgaagatgag
gaggaggaagccatggaagttaagtatggctcccccagcgatgtctcaagtgccgagcaa
atggatgttgcaatgtccaaagggcaccccaaagtgaccatgaatgattttgactacctc
aaattgctgggaaaagggacctttgggaaggttatccttgtccgagagaaagctaccgga
cgttactacgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgct
catacacttacagaaagcagagttttgcagaacacaaaacacccgtttttgacggcatta
aagtatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtgga
gagctttttttccatctttcacgagaacgagtttttacagaggacagagcacgcttttat
ggagcagagattgtgtctgctttagaatatctacattctcgaaatgtggtatacagagac
atcaagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggt
ttgtgtaaagaaggcatcacagatggagctaccatgaggaccttctgtggcacaccagag
taccttgcccctgaggtgcttgaagataatgactatggtcgagctgtggactggtggggt
cttggagttgtgatgtatgaaatgatgtgtggacgattgcccttttataaccaagaccat
gagaggttatttgaactcatcctcatggaagagatccgctttccccgtacgttaagccca
gaggcaaaatctctgcttgctggactcttgaaaaaggatcctaaacagagactaggaggg
ggtcctaatgatgcccaagaggtcatgtcgcatcgattctttgtttctatcaattggcaa
gatgtaacggagagaaagctcacccctccattcaagccacaagtcacatcagagattgac
acaagatattttgatgacgagtttacagctcagtctataacattgacgcctcccgacaga
tatgataacctcgatgccttagaatcagatcagcgccctcattttcctcaattctcttat
tctgcaagcatacgggagtaa

KEGG   Xenopus laevis (African clawed frog): 399170
Entry
399170            CDS       T01010                                 

Gene name
akt1.S, akt-1, pkb, v-akt, v-akt1, xAct
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 1 S homeolog
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    399170 (akt1.S)
   04012 ErbB signaling pathway
    399170 (akt1.S)
   04370 VEGF signaling pathway
    399170 (akt1.S)
   04371 Apelin signaling pathway
    399170 (akt1.S)
   04068 FoxO signaling pathway
    399170 (akt1.S)
   04150 mTOR signaling pathway
    399170 (akt1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    399170 (akt1.S)
  09143 Cell growth and death
   04210 Apoptosis
    399170 (akt1.S)
   04218 Cellular senescence
    399170 (akt1.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    399170 (akt1.S)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    399170 (akt1.S)
   04625 C-type lectin receptor signaling pathway
    399170 (akt1.S)
  09152 Endocrine system
   04910 Insulin signaling pathway
    399170 (akt1.S)
   04920 Adipocytokine signaling pathway
    399170 (akt1.S)
   04914 Progesterone-mediated oocyte maturation
    399170 (akt1.S)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    399170 (akt1.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    399170 (akt1.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    399170 (akt1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    399170 (akt1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399170 (akt1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   399170 (akt1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 399170
NCBI-ProteinID: NP_001083878
Xenbase: XB-GENE-484957
UniProt: Q98TY9
LinkDB
Position
8S
AA seq 481 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAKC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREEWIQVIQHVADNLKKQEEEMMEV
RSGDSPSDNSGAEEMEVSHSKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLLPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEK
KLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNFEFVDNERRPHFPQFSYSASGN
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaagtagcgatagtgaaggaaggctggctgcacaaaagaggtgaatacataaag
acctggcgtccccgctacttcctcctcaaatctgacggtactttcattgggtacaaagag
cgtccacaagatgttgaccagttggaaactcctttaaataatttctctgtagccaaatgt
cagctgatgaagacagaacgaccaaaaccaaacacatttatcattcggtgcctccagtgg
accacagtaattgaaagaacatttcatgtggattctccagaggagcgggaagaatggatt
caggtgatacaacatgtagccgacaacctcaagaagcaggaagaagaaatgatggaggtt
cggtccggcgactcgccaagtgataattctggagctgaggaaatggaagtttctcattcg
aaaccaaaacataaagttacaatgaatgaatttgagtatctcaagcttttggggaaagga
acgtttggaaaagttattttagtaaaagagaaagcaacaggacgatattacgctatgaaa
attttaaaaaaagaagttattgttgcaaaggatgaagtagcccacacgcttacggaaaac
cgcgtcctacagaattctaggcatcccttcctaacagcattaaaatattcttttcagact
catgatcgcttatgttttgtgatggagtatgccaatggaggagagttattcttccactta
tcaagagaacgtatattctctgaagatcgtgcccggttttatggggcagagattgtttct
gctttagattatcttcattctgagaaaaatgtagtttacagagacttgaagttggaaaat
ctaatgctggacaaagacggacacataaagataacagattttggactgtgcaaagaagga
ataaaagatggagcaaccatgaagaccttctgtggaacaccagaatatcttgctcctgag
gtgctagaagataatgactatggtcgtgctgtagactggtggggcttgggcgtagtgatg
tacgagatgatgtgcgggcgcctccctttctacaatcaggaccatgaaaaattgtttgaa
cttattcttatggaagaaattagattcccacgcactttattgccagaagccaagtctttg
ctgtctggtttgttgaagaaggaccctaagcaaaggttaggtggtgggccagacgatgca
aaagaaatcatgcaacacaaattttttgctggaatagtatggcaagatgtttatgagaag
aagcttgttcccccatttaagccacaagtaacgtcagaaacagacacaaggtattttgat
gaagaattcacagcgcagatgatcaccatcacaccacctgaccaagatgacaatttcgaa
tttgtagacaacgagaggcggccgcacttcccccagttttcatactctgctagtggaaat
gcttag

KEGG   Xenopus laevis (African clawed frog): 432172
Entry
432172            CDS       T01010                                 

Gene name
MGC78893, akt2-b
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase B
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    432172 (MGC78893)
   04012 ErbB signaling pathway
    432172 (MGC78893)
   04370 VEGF signaling pathway
    432172 (MGC78893)
   04371 Apelin signaling pathway
    432172 (MGC78893)
   04068 FoxO signaling pathway
    432172 (MGC78893)
   04150 mTOR signaling pathway
    432172 (MGC78893)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    432172 (MGC78893)
  09143 Cell growth and death
   04210 Apoptosis
    432172 (MGC78893)
   04218 Cellular senescence
    432172 (MGC78893)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    432172 (MGC78893)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    432172 (MGC78893)
   04625 C-type lectin receptor signaling pathway
    432172 (MGC78893)
  09152 Endocrine system
   04910 Insulin signaling pathway
    432172 (MGC78893)
   04920 Adipocytokine signaling pathway
    432172 (MGC78893)
   04914 Progesterone-mediated oocyte maturation
    432172 (MGC78893)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    432172 (MGC78893)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    432172 (MGC78893)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    432172 (MGC78893)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    432172 (MGC78893)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     432172 (MGC78893)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   432172 (MGC78893)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 432172
NCBI-ProteinID: NP_001085101
UniProt: Q6IP76
LinkDB
Position
8S
AA seq 485 aa
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPDSTEHSLLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKATGL
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTGLKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEETRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPDDAQEVMSHGFFASINWQD
VTERKLSPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESEQRPHFPQFSYS
SSIRE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatataaaa
acatggagaccaagatatttccttctgaaaagtgatggttcatttattggctataaagag
aaacctgactccacagagcacagtcttcttcctcccctcaataacttctctgttgcagaa
tgtcagctaatgaagacggagcggcctaggcccaacacatttgtgattcggtgcttacaa
tggacgacagttattgaacggacttttcatgttgacacaccagaggaaagggaagaatgg
attattgccatccagacagtggccaatggcctgaagaaccaggtacctgaagatgaagag
gaggaagccatggaagttaagtatggctcccccagtgatgtctcgagtgcagagcagatg
gacgttgcaatgtccaaagggcgccccaaagtgaccatgaatgattttgactacctcaaa
ttgctgggaaaagggacctttgggaaggttatccttgttcgagagaaagctaccggactt
tactatgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgctcat
acactaacagaaagcagagttttgcagaacacaaaacacccgtttttaacgggattaaag
tatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtggagag
ctttttttccacctttcacgagaacgagtttttacagaggacagagcacgcttttatggt
gcagaaattgtgtcggctttagaatatctacattctcgaaacgtagtatacagagacatt
aagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggtttg
tgtaaggaaggcatcacagatggagccactatgaggactttctgtggcacaccagagtat
cttgcgcctgaggtgcttgaagataacgactatggccgagccgtggactggtggggtctc
ggagttgtgatgtatgaaatgatgtgtggccgattgcccttttataaccaagaccatgag
aggttattcgaacttatcctcatggaggagacccgctttccccgtacattaagtccagag
gcaaaatctctgcttgctgggcttttgaaaaaggatcctaaacagagattaggagggggt
cctgatgatgcccaagaggtcatgtcgcatggattctttgcttctatcaattggcaagat
gtaacggagagaaagctctcccctcctttcaagccacaagtcacatccgagattgacaca
agatattttgatgacgagtttacggctcagtctataacattgacccctcctgacagatat
gataaccttgatgccttagaatcagagcagcgccctcattttcctcaattctcttattct
tcaagcatacgggaataa

DBGET integrated database retrieval system