KEGG   Xenopus laevis (African clawed frog): 108699242Help
Entry
108699242         CDS       T01010                                 

Gene name
ganc.L
Definition
(RefSeq) glucosidase, alpha; neutral C L homeolog
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108699242 (ganc.L)
   00500 Starch and sucrose metabolism
    108699242 (ganc.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108699242 (ganc.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 108699242
NCBI-ProteinID: XP_018086689
Xenbase: XB-GENE-17330918
UniProt: A0A1L8FAY2
LinkDB All DBs
Position
8L
AA seq 917 aa AA seqDB search
MSLQEPAPLTPHASDTDATLDGILTEDKKKFKTCSQIGFYRRQKLLLPGQSPYYADLETV
IVDKGITTLQIINQDTKVPLQLQIIPCESIFRLKINEISPLKPRYEVPDVIVKDMATERL
SVSQRESGSIVLENPNGPYKIHITAQPFSVSVTADDKLLLSLNSQGLLYFECLVSPQSKS
AILESDSDVTKDEYGLWREKFGEFVDIKASGPTSVGLDVSLHGFEYVYGLPEHADTHRLQ
NTEDNDAYRLYNLDVFAYKVYDKMGTYGSVPLLLAHKPLQTCGLFWLNASETLVEINTRA
VPQSSLSRSVPDTRKQRAIPQTEVRWMSESGIVDLFLLMGPSPQDVFRQYAHLTGFQALP
PLFSLGYHQCRWNYEDEADVEAVDLGFDLNNIPYDVIWLDIEHTDGKRYFTWDPERFRNP
TRMQEQLKQKKRKLVVISDPHIKVDPDYSLYSQAKARGYFVKDRDGQDFEGNCWPGTSCY
LDFTNPAVRDWYAAQYALDSYKDSTEVLFVWNDMNEPSVFEAPEMTMPKSAVHYKGCEHR
DLHNLYGFYQQMSTFKGLIQRSAGQERPFVLTRSFFAGSQRYGAVWTGDNKADWEYLKIS
VPMLLTLNVTGISFCGADVGGFVGDPEPELLIRWYQAGAFQPFFRAHAVQNSKRREPWLF
GKDNILLLKRVIEERYTLLPFWYLLFYQAHVSAQPVMRPLWVEFPKHPESFGEETQYMLG
SALLVVPVLAPGVSALDVLFPGSGERWYNFRKYECMRGPHRKKIKVTLDEIPVFQRGGSI
IPLHTRVGKSTGWMDGFPYELRVALDSKGFAEGELFLDDGHSFNYIRDSMFTHRKFALQK
NVLSSSSADSKGKYQSESIVERVQLMGVKKQPLEVILHSSGVKTNVAFTYSAKLCLLSLE
SLSLCVSTDWEIHIRDK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccaggaaccagccccgctgaccccccatgcctctgacactgatgcaacccta
gacggcattctcactgaagacaagaaaaaattcaagacctgcagtcaaattggcttttac
aggaggcagaagcttctccttccgggccaatcaccatattatgctgatctggaaacagtc
atagttgataaaggtattaccaccctgcagatcattaaccaggacacaaaggttcctctt
cagcttcaaatcataccttgtgaaagcatcttcaggcttaagatcaatgagatatctcca
ctgaaaccaagatacgaggttcctgatgtcatagtgaaagatatggctactgaaaggcta
agcgtgtcacagcgggaatctggcagcattgttttggagaatccaaatggcccttacaag
atacacatcacagctcagccattttctgtctcagtaactgcagatgacaagcttcttctt
agtcttaattcccagggattgttatattttgaatgtctggtttctccacaatcaaaaagt
gcaattttagagagtgacagtgatgtgacaaaggatgagtatggactttggagagaaaag
tttggggaatttgtggacattaaggccagtggtccaacttctgttggcctggatgtttca
ctacatggatttgagtatgtgtatggattgccagaacatgctgatacacaccgactccaa
aatacagaggacaatgacgcatatcgactgtataacttagatgtgtttgcatacaaagtc
tatgataagatgggaacatatggatctgtgccactgctcctagcacacaaacccttgcag
acatgtgggcttttctggctcaatgcttcagagacactggtagaaatcaatacgagggca
gtaccacagtcttctttgtctaggtctgtcccagatacacgcaagcagagggccatccca
cagacagaagttcggtggatgtctgagagtggcattgttgatttgttcctgttaatggga
ccttcaccacaagacgtgtttagacaatatgctcatctcacaggtttccaggctttacca
cctctgttttccttgggttaccaccaatgtcgttggaactatgaggatgaagcagatgtg
gaagcagtggatttgggctttgatctaaacaatatcccttatgatgtcatctggttggac
attgagcacacagatggaaaaaggtactttacgtgggatcctgaaagattccgtaatcca
accaggatgcaggagcagctaaaacagaaaaaacgcaagctggttgtcatttcagatccc
catattaaggtagatccagactatagcctgtattctcaagccaaggccagaggctacttt
gtcaaggacagagatggacaagactttgaaggcaactgctggccaggcacatcctgttac
ttggactttacaaatcctgctgtacgagactggtacgcagctcaatatgcacttgattcc
tataaagattctacagaagtcctctttgtttggaatgacatgaatgaaccctcagtgttc
gaagccccagagatgaccatgccaaaaagtgctgtgcattacaaaggctgtgaacacagg
gaccttcataacctctatggtttctaccagcaaatgtctaccttcaagggtttgatacag
aggtcagctggacaggagagaccctttgtcctgacaaggtcattctttgctggctcacag
agatatggtgcagtatggactggtgacaataaagcagactgggaatacttaaaaatatca
gttccaatgctgctcacgctaaatgtaactgggatttccttctgtggagctgatgttgga
gggtttgttggagacccagaaccagagctccttattcgatggtaccaggccggtgccttt
cagccctttttccgagcacatgccgttcagaacagcaaaaggcgtgagccctggctgttt
ggaaaagacaacattttgctgctaaagagagtgatagaggagagatatactctacttcca
ttctggtacctgctcttttaccaagcccatgtgtctgcccagccagtgatgaggcctctg
tgggtagaattccccaagcatcctgaaagctttggagaagagacacagtacatgctagga
agtgccctgctggttgtgcccgtgttagctccaggtgtctctgcattggatgttctgttt
cctgggtctggagagcgctggtacaactttagaaaatacgagtgtatgaggggccctcac
agaaagaaaataaaagttacattggatgagattccagtgtttcagcgtggaggctcaatt
attccactgcatacaagggttggtaaatccacaggctggatggatggttttccttacgag
ctgcgagtagctctggattcaaagggctttgctgaaggggagctgtttttggatgatggc
cattctttcaactatatccgggacagcatgttcactcaccggaagtttgcactccaaaaa
aatgtgttgtcatccagttctgctgactcaaagggcaaatatcaatcggagtccattgtg
gagagggtgcagttaatgggtgttaagaaacaaccactggaagtcattttgcacagttca
ggagtcaagacaaatgtggccttcacctacagtgccaaactctgtctcctgagcctggaa
tccctctccttgtgtgtgtccactgactgggagatccacatcagagacaaatga

DBGET integrated database retrieval system