KEGG   Xenopus laevis (African clawed frog): 108700199Help
Entry
108700199         CDS       T01010                                 

Gene name
mark4.S, mark4l, mark4s, markl1, markl1l
Definition
(RefSeq) MAP/microtubule affinity-regulating kinase 4 S homeolog
  KO
K08798  MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108700199 (mark4.S)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xla04812]
    108700199 (mark4.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108700199 (mark4.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108700199 (mark4.S)
Cytoskeleton proteins [BR:xla04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     108700199 (mark4.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr UBA Kinase-like UBA_2 Kdo RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108700199
NCBI-ProteinID: XP_018088654
Xenbase: XB-GENE-6485622
LinkDB All DBs
Position
8S
AA seq 681 aa AA seqDB search
MSRVSAGNERINDTSGSTRSEKASAPLSWPHRPPGARSRSSAQEEPHVGNYRLLRTIGKG
NFAKVKLARHVLTGREVAIKIIDKTQLNSSSLQKLFREVRIMKGLNHPNIVKLFEVIETE
KTLYLIMEYATGGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLL
LDSESNIKIADFGFSNEFTLGGKLDTFCGSPPYAAPELFQGKRYNGPEVDVWSLGVILYT
LVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCESVLRRFLVLNPSKRCTLEQIMNDK
WINIGFDSDDLKPYKEPEEDNADAKRIEIMLEMGYSRDEIKDALSSSKYNEVMATYLLLG
RKPDSEGGESRSDSTLSLSRSRVASDVTNGATKSSSVHSKNQRGYQRQRRHSDFCGPAPA
PSQAKRSPPGVSDEGAVGERLAPRRGSGSVGGGSRPPPPSSPMVSHAHNPNKSEIPEPRK
EAPPTTMNTPPGVMGRRNTYVCTDRHSSDRHSLLHNDKENSSTPSRPPALSPSTQSIAER
SSLSRGSNVRSTFHGGHVRDRRGQNPPPSSPTHPHEGLNQSRTRATSNLFSKLTSKLTRR
VTDESERVWRSEVTGSYIPWNKASANSSLLRPPRDVRRSAQRPPLQSTETSIAPTSLSSV
GRPSPLPGKLRPLITVWTVGL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgtttccgctggcaacgagaggataaatgacacgtctggttccacccgctca
gaaaaggcctctgcacctttatcctggccacatcgacctccaggagcccggtccagaagt
tctgctcaagaggagccacatgttgggaattacagactcctaagaaccattggaaaaggg
aactttgccaaagttaagctggcaagacatgtccttactgggagagaggttgctataaag
atcattgacaagacacagctgaattccagtagtctgcaaaagctatttcgtgaggttcga
atcatgaaaggacttaatcatcccaatattgtgaagctgtttgaagttatagaaactgaa
aaaacgctgtatctcatcatggaatatgctactggaggtgaggtgtttgactatttagtg
tctcacggacgtatgaaagagaaagaagctcgtgccaaattcagacagattgtctctgca
gtccattactgtcatcagaagaacattgttcatcgtgatcttaaggctgagaatctcctc
cttgattcagagtccaatataaaaattgcagactttgggttcagtaatgagtttactcta
ggtgggaaattagacactttctgtggtagccccccttatgctgctcctgagctctttcag
ggaaagaggtacaatggacctgaggtggatgtctggagtctgggcgttatcttatacaca
ttggtcagtggatccctgccatttgatgggcagaatcttaaggaactgagagagcgagtt
ctgcgtgggaaatatagaattccattttatatgagcacagactgtgagagtgttctacga
agattcctagtgctaaatccaagcaagaggtgcactttggagcaaataatgaatgacaag
tggataaatattggattcgatagtgatgatctaaagccatataaagaaccagaggaggac
aatgcagatgccaagcgcattgagattatgttggaaatgggttactcgcgtgacgagatt
aaagatgctctgagctcaagcaagtacaatgaagtgatggctacatacctgctgctggga
aggaagcctgatagtgaaggaggagagtctcgttcagacagcaccctttcactctctcgg
tcccgtgttgcctcagatgttaccaacggtgccaccaagtcatcatcagtacacagcaaa
aaccagagaggctatcaaagacagagacgacacagtgacttctgtggtcctgccccagct
ccttcccaggccaagcgcagcccccctggagtcagtgatgaaggtgccgttggagagcgt
cttgccccccggaggggtagtggatcagtgggtgggggcagccggcctccccctccctca
agtcccatggtcagccatgcccacaaccctaacaagtcagagattcctgagccacggaag
gaggctccaccaaccactatgaatactccacccggggtgatgggccgtagaaatacgtat
gtttgcacagatcggcacagctctgaccgacattcacttctccataacgacaaagaaaac
agctcaaccccatctcgtccgcctgcactttcaccatccacacagagtattgcagagcgt
agcagtctttccaggggatccaatgtccgtagcactttccatgggggccatgtgagggat
cggagaggccaaaacccaccccctagttctccaacccatcctcatgaaggactaaatcag
agtcggacccgagccacgtcaaacctgtttagtaaactgacctccaaactgacccgcagg
gtcacagacgaatctgagagagtctggagatctgaggtcacaggtagctatataccttgg
aataaagcgtcggccaactccagcctgctcagacctcccagggatgtgagaaggtcagct
cagcgcccacccttgcagtcaacagaaacctccattgctcccaccagcctttcctcagta
ggaaggccaagccccctaccaggcaagctacgcccactaatcactgtttggacggtggga
ctttaa

DBGET integrated database retrieval system