KEGG   Xenopus laevis (African clawed frog): 108700276
Entry
108700276         CDS       T01010                                 

Gene name
tgfb1.S, TGF-beta5, ced, dpd1, lap, tgf-beta, tgfb, tgfb5, tgfbeta
Definition
(RefSeq) transforming growth factor beta 1 S homeolog
  KO
K13375  transforming growth factor beta-1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108700276 (tgfb1.S)
   04350 TGF-beta signaling pathway
    108700276 (tgfb1.S)
   04068 FoxO signaling pathway
    108700276 (tgfb1.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108700276 (tgfb1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108700276 (tgfb1.S)
   04218 Cellular senescence
    108700276 (tgfb1.S)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    108700276 (tgfb1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    108700276 (tgfb1.S)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    108700276 (tgfb1.S)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    108700276 (tgfb1.S)
Chaperones and folding catalysts [BR:xla03110]
 Intramolecular chaperones
  Others
   108700276 (tgfb1.S)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108700276 (tgfb1.S)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108700276 (tgfb1.S)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 108700276
NCBI-ProteinID: XP_018088820
Xenbase: XB-GENE-17343754
UniProt: A0A1L8F3Y7
LinkDB
Position
8S
AA seq 382 aa
MEVLWMLLVLLVLHLSTLTMSMSTCKAVDMEDVRKRRIEAIRGQILSKLKLDKTPDVDSE
KMTMPSEAIFLYNSTLEVIREKAAREEEHVGQEQNIQDYYAKQVHRFKSTNHLEDRIFKF
IFNASNVRENVGNKSLLHHAELRVYRKKQTDKNSSQRMELFWENKENVSRSRYLDSKYFT
PVTDDEWVSFDVTKTVNEWLKHAEEDEEFRLQPACKCESEQTKNIDIEGFPIKRGDMGDL
GSDEFKKPYLMITSMPAERIDKVTSSRKKRGVGQDYCFVNTGPNCCVKPLYINFRKDLGW
KWIHEPKGYEANYCLGNCPYIWSTDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIY
YVGRNAKVEQLSNMVVRSCHCS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaggttctgtggatgctgctggtgctgttggtcctgcatctttccactttaactatg
tccatgtctacctgcaaggctgtggatatggaagacgtcaggaagaggagaattgaagcc
atcaggggccaaattctcagcaaactaaaactggacaaaacaccagacgtagacagtgag
aagatgacaatgcccagcgaagccatcttcctttataatagcaccttggaggtgatcaga
gaaaaagcagccagagaagaagaacatgtggggcaagagcagaacatacaggactattat
gcaaaacaagtacacagatttaaaagcacgaaccacctggaagaccgtatatttaagttt
atatttaatgcttcgaatgtgagggagaacgtgggtaacaagtctcttctgcaccatgcg
gagctgcgcgtgtacaggaagaagcagacagataaaaatagcagtcaaaggatggaatta
ttctgggaaaataaggaaaatgtgtcaagatcaagatacctggatagcaagtactttact
ccagtaacagatgatgagtgggtgtcgtttgatgttacaaagactgtaaatgaatggctg
aaacatgcagaggaggatgaagaattcaggttgcagcctgcctgcaaatgtgaaagcgaa
cagaccaagaacatagacatagaagggtttcctattaagcgtggagacatgggggatttg
ggttccgatgaattcaagaaaccctacctgatgatcacttcaatgccagccgagcgtatt
gacaaggttacaagctcacggaaaaagcgtggggttggacaggattattgctttgtgaac
actggaccaaactgctgtgtgaaacctctttacataaatttccgcaaggatctaggctgg
aagtggatccatgaacctaagggttatgaagcaaattattgtttaggaaattgtccttac
atctggagcacagatactcagtacagcaaggtgctatccctttacaatcagaacaatcct
ggtgcatccatttctccctgctgtgttcctgatgtcctggagccactgccaatcatttat
tatgttggccgcaatgccaaggttgagcagctctctaatatggtggtaaggtcttgccac
tgcagctga

KEGG   Xenopus laevis (African clawed frog): 108717706
Entry
108717706         CDS       T01010                                 

Gene name
tgfb2.S, tgf-beta2
Definition
(RefSeq) transforming growth factor beta 2 S homeolog
  KO
K13376  transforming growth factor beta-2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108717706 (tgfb2.S)
   04350 TGF-beta signaling pathway
    108717706 (tgfb2.S)
   04068 FoxO signaling pathway
    108717706 (tgfb2.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108717706 (tgfb2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108717706 (tgfb2.S)
   04218 Cellular senescence
    108717706 (tgfb2.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    108717706 (tgfb2.S)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    108717706 (tgfb2.S)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108717706 (tgfb2.S)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108717706 (tgfb2.S)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 108717706
NCBI-ProteinID: XP_018120465
Xenbase: XB-GENE-17339019
LinkDB
Position
5S
AA seq 445 aa
MHYYVLFACLTLELAPVALSLSTCSALDMDQFMRKRIEAIRGQILSKLKLNSPPEDYPEP
GEVSQDVISIYNSTRDLLQEKANERAASCERERSEDEYYAKEVYKIDMLPYFTSERYAIP
KVKRKCDRRIKGKEKGYLEGKKNSRKGDVILPSYTTPYFRIVRFDVASMEKNASNLVKAE
FRVFRLMNPKARVSEQRIELYQILKSKDLASPTQRYIDSKVVKTRAEGEWLSFDVTEAVN
EWLHHKDRNLGFKISLHCPCCTFIPSTNYIIPNKSEELETKFAGIDDAYMYAGVDPRTKT
GRKKHTGRTPHLLLMLLPSHRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRD
LGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLGLYNTINPEASASPCCVSQDLDSLT
ILYYIGNKPKIEQLSNMIVKSCKCS
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcactactatgtcctatttgcctgcctgaccttggaactggcccctgtggccctcagc
ctgtctacctgcagtgccctggacatggatcagttcatgcgcaagaggattgaggccatt
agggggcagatcctgagcaagctgaagctaaacagcccccctgaggattacccggagccc
ggagaggtttcccaggatgtcatttctatctacaacagcactagagaccttcttcaggag
aaggccaacgagagagctgcctcctgtgagagggagaggagtgaagatgagtattatgcc
aaagaggtttacaaaattgacatgctcccctacttcacctctgaaagatatgctatacca
aaagttaagagaaaatgtgatagaagaataaaagggaaggagaaaggatacttagaagga
aagaagaatagcaggaaaggagatgtcattctaccaagttatacaaccccatacttccga
attgtacgatttgacgtcgcttcaatggagaaaaatgcttccaacctggtcaaggcagaa
tttagagtatttcgtttaatgaatccaaaggcacgggtatcagaacaacgaatagaatta
tatcagattctaaagtcgaaagatttggcctcaccaacgcaacgctatattgacagcaaa
gtagtaaagacaagagcagagggagaatggttatccttcgatgtcacagaggcagtcaat
gaatggctccatcacaaagacagaaatcttggatttaaaataagtttgcactgtccctgt
tgcacatttattccttccactaactacatcattccaaacaaaagtgaagaattggaaacc
aagtttgcaggtattgatgatgcctacatgtatgctggtgtagatcccaggacgaagact
ggccggaagaagcacacaggcagaactccccacctcctgctcatgctgctgccttcacac
agactcgagtcccagcaatccagccgaaggaagaaaagagctctcgatgctgcctattgc
tttaggaacgttcaggacaattgctgtctacgtcccttatacattgactttaaaagagac
cttggttggaagtggatacatgaacccaaaggttacaacgcaaatttttgtgccggagct
tgtccatatctgtggagctcagatacacaacatagccgggtgctaggcctgtacaacacc
attaatccggaagcatctgcctccccgtgttgtgtatctcaagatttagactccttgacc
atcttgtactacatcgggaataagccaaaaattgaacagctttcaaatatgattgtaaaa
tcatgcaagtgcagctaa

KEGG   Xenopus laevis (African clawed frog): 373801
Entry
373801            CDS       T01010                                 

Gene name
tgfb2.L, tgf-beta2, tgfb2, tgfb2-A
Definition
(RefSeq) transforming growth factor beta 2 L homeolog
  KO
K13376  transforming growth factor beta-2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373801 (tgfb2.L)
   04350 TGF-beta signaling pathway
    373801 (tgfb2.L)
   04068 FoxO signaling pathway
    373801 (tgfb2.L)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    373801 (tgfb2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    373801 (tgfb2.L)
   04218 Cellular senescence
    373801 (tgfb2.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    373801 (tgfb2.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    373801 (tgfb2.L)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   373801 (tgfb2.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   373801 (tgfb2.L)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 373801
NCBI-ProteinID: NP_001079195
Xenbase: XB-GENE-865387
UniProt: P17247 A0A1L8G6B2
LinkDB
Position
5L
AA seq 413 aa
MHYYVLFTFLTLDLAPVALSLSTCSALDMDQFMRKRIEAIRGQILSKLKLNSPPEDYPEP
GEVSQDVISIYNSTRDLLQEKANERATSCERERSEDEYYAKEVYKIDMLPYYTSENVIPP
SYTTPYFRIVRFDVSSMEKNASNLVKAEFRVFRLMNTKARVSEQRIELYQILKSKDLASP
TQRYIDSKVVKTRAEGEWLSFDVTEAVNEWLHHKDRNLGFKISLHCPCCTFIPSNNYIIP
NKSEELETRFAGIDDAYMYAGGDSKSKTGRKKHTGRTPHLLLMLLPSYRLESQQSSRRKK
RALDAAYCFRNVQDNCCLRPLYIDFKKDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHS
RVLSLYNTINPEASASPCCVSQDLDSLTILYYIGNKPKIEQLSNMIVKSCKCS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcactactatgtcctgttcaccttcctgaccctggacctggcccccgtggccctcagt
ctgtccacctgcagtgccctcgacatggatcaattcatgcgcaagaggatcgaggccatt
agggggcagatcctgagcaaactgaaattaaacagcccccctgaggattacccggaaccc
ggagaggtttcccaggatgtcatttctatctacaacagcaccagagaccttcttcaggag
aaggccaacgagagagctacctcctgtgagagggagaggagtgaagatgagtattatgcc
aaagaggtttacaaaattgacatgctaccctattacacctctgaaaatgtcattccacca
agttataccaccccatacttccgaatcgtacgatttgatgtctcttcaatggagaaaaat
gcttccaacctggtgaaggcagaatttagagtgtttcgtttaatgaatacaaaggcacgg
gtatcagaacaacggatagaattatatcagattctaaagtcgaaagatttggcttcacca
acgcaacgctatattgatagcaaagtagtaaagacaagagcagagggagaatggctatcc
ttcgatgtcacagaggcagtcaatgaatggctccatcacaaagacagaaatcttggattt
aagataagtttgcactgtccctgctgcacctttattccttctaataactacatcattcca
aacaaaagtgaagaattggaaaccaggtttgcaggtattgatgatgcctacatgtatgct
ggtggggattccaagagcaagactggccggaagaagcacacaggcagaactccccacctc
ctgctcatgcttttgccttcatataggcttgagtctcagcaatccagccgaaggaagaaa
agagctctcgatgccgcctactgctttaggaacgtccaggacaattgctgtctacgtccc
ttatacattgactttaaaaaggaccttggttggaagtggatacatgaacccaaaggttac
aatgcaaatttctgtgctggagcttgtccgtatctgtggagctcagatactcaacatagc
cgggtgctaagcctgtacaacaccattaatccggaagcatctgcctccccgtgttgcgtg
tctcaagatttagactccttgaccatcttgtactacatcgggaataagccaaaaattgaa
cagctttcaaatatgattgtaaaatcatgcaagtgcagctaa

KEGG   Xenopus laevis (African clawed frog): 397778
Entry
397778            CDS       T01010                                 

Gene name
tgfb1.L, TGF-beta5, ced, dpd1, lap, tgf-beta, tgfb, tgfb1, tgfb5, tgfbeta
Definition
(RefSeq) transforming growth factor beta 1 L homeolog
  KO
K13375  transforming growth factor beta-1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397778 (tgfb1.L)
   04350 TGF-beta signaling pathway
    397778 (tgfb1.L)
   04068 FoxO signaling pathway
    397778 (tgfb1.L)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397778 (tgfb1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397778 (tgfb1.L)
   04218 Cellular senescence
    397778 (tgfb1.L)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    397778 (tgfb1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    397778 (tgfb1.L)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    397778 (tgfb1.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    397778 (tgfb1.L)
Chaperones and folding catalysts [BR:xla03110]
 Intramolecular chaperones
  Others
   397778 (tgfb1.L)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   397778 (tgfb1.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397778 (tgfb1.L)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 397778
NCBI-ProteinID: NP_001081330
Xenbase: XB-GENE-865765
UniProt: P16176 A0A1L8F936
LinkDB
Position
8L
AA seq 382 aa
MEVLWMLLVLLVLHLSSLAMSLSTCKAVDMEEVRKRRIEAIRGQILSKLKLDKTPDVDSE
KMTVPSEAIFLYNSTLEVIREKATREEEHVGHDQNIQDYYAKQVYRFESITELEDHEFKF
KFNASHVRENVGMNSLLHHAELRMYKKQTDKNMDQRMELFWKYQENGTTHSRYLESKYIT
PVTDDEWMSFDVTKTVNEWLKRAEENEQFGLQPACKCPTPQAKDIDIEGFPALRGDLASL
SSKENTKPYLMITSMPAERIDTVTSSRKKRGVGQEYCFGNNGPNCCVKPLYINFRKDLGW
KWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIY
YVGRTAKVEQLSNMVVRSCNCS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaggttctgtggatgctgctggtgctattggtcctgcatctttccagtttagctatg
tccttgtctacctgtaaggctgtggatatggaagaagtcaggaagaggagaattgaagcc
atcaggggccaaattctcagcaagctaaaactggacaaaacaccagatgtagacagcgag
aagatgacagtgcccagtgaagccatcttcctttacaatagcaccttggaggtgatcaga
gaaaaagcaaccagagaagaagaacatgtagggcatgatcagaacatacaggactattat
gcaaaacaagtttaccgatttgaaagcataaccgaactggaagaccatgaatttaagttt
aaatttaatgcttcgcatgtgagggagaatgtaggtatgaactctcttctgcaccatgct
gagctgcgcatgtacaagaagcagacagataaaaacatggatcaaaggatggaactattc
tggaaataccaggaaaatgggaccactcactcaagatacctggagagcaagtacattact
ccagtaacagatgatgagtggatgtcatttgatgttacaaagactgtgaatgaatggctg
aaacgtgcagaggaaaatgaacaattcgggttgcagcctgcctgcaaatgtcccacccca
caggccaaagatatagacatagaaggatttcctgctttacgtggagacttggcgagtttg
agttccaaagaaaacacgaaaccctacctgatgatcacttcgatgccagctgagcgtatt
gacacagttacaagctcacggaaaaagcgaggggttggacaggagtattgctttgggaac
aatgggccaaactgctgtgtgaaacctctttacataaattttcggaaggatctaggctgg
aagtggatccatgagcctaagggatatgaagcaaattattgtttaggaaattgtccttac
atctggagcatggatactcagtacagcaaggtgctatcactttataatcagaacaatccc
ggtgcatctatatctccctgctgtgttcctgatgtcttggagccactgccaatcatttat
tatgttggccgcactgctaaagtagagcagctctctaatatggtggtaaggtcttgcaac
tgcagctga

DBGET integrated database retrieval system