KEGG   Xenopus laevis (African clawed frog): 108700333Help
Entry
108700333         CDS       T01010                                 

Gene name
setdb1.S
Definition
(RefSeq) SET domain, bifurcated 1 S homeolog
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108700333 (setdb1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108700333 (setdb1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108700333 (setdb1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108700333 (setdb1.S)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108700333 (setdb1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4573 DUF4537
Motif
Other DBs
NCBI-GeneID: 108700333
NCBI-ProteinID: XP_018088918
Xenbase: XB-GENE-17337298
LinkDB All DBs
Position
8S
AA seq 1297 aa AA seqDB search
MRSPMLEMESQEKMESQETMELEQVVVKELGISMDDLRELIDKELEKMEVVKQKKAQLLE
LEQLVKQKEAEVEHVDKLFDNATKAVDDCEALVKSLYDQIGMTYKESSSEDEGASKPVEV
IEIPDEDDDDDVMSVGSGEAVSKIPKEKHLLREAMAAMKRSRQDVQSIVEAIQKKSDGPQ
TKFSSHPSSTTSSVGGSNQAGASNDMSKDGDLVVGMRILGKKRTKTWHKGTLISIQCVGP
GKKYKVKFDNKGKSLLSGNHIAYDYHPPPENLTVGSRVVAKYKDGNQVWLYAGIVAEPPS
NKNKMRYLIFFDDGYASYVTHPELYPVCRPLINSWEDIEDVSCRDFIQEYVNAYPNRPMV
LLKSSQLIKTEWEGTWWKSKVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTA
STQEKKQAGQQRTRPNVGAIRSKGPVVQYTHDLTGNEPEHKPAAPPSPHSIPSPQLIDTD
SDSQQAQSKKQVAKKSTSFRPGSAGSGQSSPIPTESVPPPPAAPRPFQPTQSNQSNQSAQ
PVQSIQPIHNIQTIQTIQGIQTIQSIQPIQTIQTLQPIQTIQPLQTIQTLQGNRIVTSIQ
QFHIIHTENIPAETTYKAPKEKLFYLPHVCNYTCLSRIRPISHRSKNPLIVPLLYDFRRM
TARRRVNRKMGFHVLYKTPCGLSLRTMPEIERYLFETECKMLFLEMFCLDPYVLVDRKFQ
PQKPYYYIPDITYGKEDVPLSCVNEIDRTPPPQVAYSKERIPGKGVFINTGADYLVGCDC
TDGCRDKSKCACHQLTIQATGCTPGAQMNSMAGYQHKRLEECLPTGVYECNKRCKCSANM
CNNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGD
EYFANLDHIESVENYKEGYESDAKSSSDSSGVDLKEDNEENSGSDDQDESNDSSDDNFGK
NEDITTSSVWRSYATRRTTRGQKENGTSETASKDSALARQTSRDETNDCKLPEETSKNKV
ASWLSSNTMADSIMDSDSRSSLKMGDAPEADKPKESEEASKYPGHGEGNRMYGYNPAPAK
KDGVRRPVSKTALHQIRRQSSSAQPTDEVLTLSSSSESEVGSGTNGSKKPAAQATANDSD
DIQTISSGSDEEEEKKHVATNAGPVKRQVAVKSTRGFALKSTHGITVKTNMASGEGGVGR
RTTRQFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKR
IRAGTELTWDYNYEVGSVEGKKLLCCCGSTECRGRLL
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctcctatgttagagatggagtcacaggagaagatggagtcacaggagacgatg
gagttggagcaggtggtggtgaaggagctgggcatttccatggatgatctgcgtgagctg
atagataaagagctggaaaagatggaagttgtgaaacagaagaaagctcagctattggaa
ctagagcaactggtgaagcagaaagaggcagaagtggagcatgtggacaagcttttcgac
aacgctacaaaggccgtggatgattgtgaggcgctagtgaagagtctgtacgaccagatt
ggcatgacttacaaagagagcagctctgaagatgaaggagcttcaaaaccagtggaggtt
attgagatccctgatgaagatgacgatgatgacgttatgagcgtgggatcaggtgaagcc
gtgagtaagattccaaaagagaagcatttgttacgagaagcaatggctgctatgaagaga
tcaagacaagatgtgcagagcattgtagaagcaatacaaaagaagtcagatggacctcag
acaaaattttcttctcatccctcctcaacaacaagctctgtgggtggctccaatcaggcc
ggtgcctcaaatgacatgagcaaagatggagaccttgtcgtggggatgcgtattctgggc
aagaagagaaccaagacttggcacaaaggaactctgatctctatacagtgtgtgggccct
ggaaaaaagtacaaggtcaagttcgacaacaaagggaaaagcttgttgtctggtaaccac
attgcttatgactaccacccgccacctgaaaatctgactgttggtagcagagtggtagcc
aagtataaagatggaaaccaggtgtggctctatgctgggattgtcgctgagcccccaagt
aacaagaataaaatgagatatctgatctttttcgatgatggctatgcatcctatgttacc
cacccagaactgtatcctgtctgcaggccattgatcaactcatgggaggacatcgaggac
gtatcctgtcgggattttattcaggaatacgtgaatgcttaccccaatagaccaatggtt
cttttgaagagtagccaactgattaaaacagagtgggaaggaacatggtggaaatccaag
gtggaagaagtagatgggagtctggtgaaaatacttttcctggatgacaagcgttgtgaa
tggatctaccgtggttctacacgcctggagcccatgttcagcatgaagacatccacggcc
tcaacacaagagaagaagcaagctgggcaacaaaggacgcgtcctaatgtgggtgccata
cggagcaagggtcctgtagtgcagtacacgcatgacctgactgggaatgagcctgaacac
aaacctgcagcacccccatctcctcattcaatcccatcaccccagcttattgacacagac
tctgacagtcagcaggcccagtccaagaagcaagtggccaagaaaagcacttcattccgt
cccgggtcagcgggatccggacagtcttccccaattcccaccgagtcagtgccgccacct
cctgctgctccgcgtcctttccagcccacccaatctaaccaatccaaccagtctgcacaa
cctgtccagtctattcagcccatccacaatatacagaccattcaaactattcaaggcatt
caaactatccaatcaatccagccaattcaaaccatacaaactctccagcctatccaaacc
attcaacctctccagacaatccagactctccaaggaaacaggattgtgacttctattcaa
caattccatataatacatacagaaaatattccagcagagaccacctacaaggcccccaaa
gagaagcttttctacctccctcacgtctgcaactacacttgcctctcccgtattcgcccg
atctctcacagaagcaagaaccccctaatagtgccactgctttatgacttccgtcgcatg
actgcccgacggcgggtcaaccgcaaaatgggtttccacgtcctctacaagacgccctgt
ggcctgagcttgcgtacaatgccggagatcgaacgttacctttttgagaccgagtgcaaa
atgctcttcctggaaatgttttgtctggacccctatgtcttggtggatcggaaatttcag
cctcaaaaaccctattactacatccccgatatcacatatggcaaggaagatgttccactt
tcttgcgtcaatgaaatagacaggacaccgccacctcaagtggcctacagcaaggagcgc
atccctgggaaaggagtcttcatcaacaccggtgccgattatcttgtgggatgtgactgc
acagatggctgtcgagacaaatccaaatgtgcatgtcaccagttgacgattcaagccaca
ggctgcactccaggggcccagatgaactcaatggctggataccagcacaagcgcttggaa
gaatgtcttcccactggggtgtacgagtgcaacaagagatgcaagtgcagtgctaatatg
tgcaacaaccgccttgtacaacatgggctccaggtgcgcctccaactcttcaaaacccaa
aacaagggctgggggatccggtgtttggatgatatagcaaaaggctcctttgtctgcatc
tatgcaggtaagatcctcacagatgactttgcagacaaagaaggtctggagatgggtgac
gagtactttgctaacttggaccacatagaaagtgttgagaactataaggaaggctatgag
agcgacgccaagtcttcctctgatagcagcggcgtcgacctcaaagaggacaacgaggaa
aacagcggcagcgatgatcaggacgagtccaacgacagttcagatgacaattttggcaag
aacgaggacatcacaaccagctcagtgtggcgcagttatgccacccgcagaacaacaaga
ggccagaaggagaacggaacgtcggagactgcttccaaggactctgctctggcccgacaa
accagtcgggatgagaccaatgactgcaaactacccgaggagacctccaagaacaaagtg
gcttcctggctaagttcaaacaccatggcagactctattatggactctgacagtaggtct
tccctaaagatgggagatgcaccagaagcagataaacctaaggaatcggaagaggcgagc
aaatacccagggcatggagaaggaaaccggatgtacggctacaatcccgctccagccaaa
aaagatggcgtgcgacgacccgttagcaaaaccgcattgcaccagatcaggcggcagtcg
agctcagcgcaacctaccgatgaagttctgaccctctccagcagctcagagagtgaggtg
ggaagtgggaccaacggcagcaaaaaacctgctgctcaggccacagcaaatgacagtgac
gatatccagacaatctcatctggatctgacgaggaagaggagaagaagcacgtagctact
aatgcaggacctgtaaaaagacaagtggctgtaaaatccacccgaggctttgccttaaaa
tccacccacgggatcactgtgaaaaccaacatggcgtcgggtgagggaggagtaggacgc
cggaccacgcgacagttcttcgatggggaggagtcctgttacattattgatgcaaaactt
gaaggcaacttgggtcgatacttgaatcatagctgcagccccaatctctttgtacagaat
gtgtttgtggatacacatgatctgcgcttcccttgggtggccttcttcgccagcaagagg
atccgcgctggtactgagctcacgtgggattataattatgaggttggcagtgtagaaggc
aagaaactcctgtgctgctgcggatccacagaatgtcgtgggcgcctcctgtaa

DBGET integrated database retrieval system