KEGG   Xenopus laevis (African clawed frog): 108700426
Entry
108700426         CDS       T01010                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108700426
   04350 TGF-beta signaling pathway
    108700426
   04371 Apelin signaling pathway
    108700426
   04068 FoxO signaling pathway
    108700426
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108700426
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108700426
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 108700426
NCBI-ProteinID: XP_018089085
LinkDB
Position
8S
AA seq 624 aa
MLCLAAGYFVPVGQLSPSLSQSVSPPSHAFLPSAHSPCPVSSLSLKFGVRSLCRATVYPD
EIPAMSLTPPNSSDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITA
ITTNGVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFD
LKYDSVCVNPYHYERVVSPGIGLSIPSTATTPCRSVKEEYVHECEMEASSCLPASQELPP
AIKHAPLPPMPPTDPYRQPLPPLTLPTSPQTAISMYSNMPHSPAVAPGCPLVPMHGEGLL
QIAPSHPQQMVSTSPPSTPSQNSHKNGYPSPSKQPFHAAWTGSSTAVYTPNPGGQQNGRG
NQQPPLHHPNNYWPLHQSSPQYQHPVSNHPGPEFWCSVAYFEMDVQVGEIFKVLSNCSVV
TVDGYVDPSGGDRFCLGQLSNVHRTDTSERARLHIGKGVQLECRGEGDVWMRCLSDHAVF
VQSYYLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGT
IPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKQTPCWIEVH
LHRALQLLDEVLHTLPMADPSSVN
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgttatgtctggctgctggttattttgttccagtgggacagctctcccccagcctgagt
cagtctgtctcccctccctcccatgctttccttccctccgctcactctccttgtcctgtt
tcttctctctctctcaagttcggggtgaggtccctctgcagagccacagtttatccagat
gagatcccggccatgtctctgacccctcctaacagcagtgatgcctgtctcagcatcgta
cacagtctcatgtgccaccggcaggggggggagaacgagggctttgccaagagagccatt
gagagtctcgtcaagaaactgaaggagaagaaagacgagctggactccctcatcactgcc
attactactaatggagtgcaccccagcaagtgcgttaccatccagcgaaccttggacggg
aggcttcaggtagccggccgtaaaggtttcccgcatgtgatctacgctcgcttgtggcgc
tggccggatctgcacaagaatgagctgaaacacgttaagttctgccagtttgccttcgac
ctgaagtatgacagcgtgtgtgtgaacccctatcactacgagcgggtggtttctcccggc
attggtctgagtatccctagcactgcaaccactccgtgccgatcagtgaaagaggagtat
gtccatgagtgtgaaatggaagcatcttcatgtctcccagcatcccaggaacttccacca
gccatcaaacatgccccccttccaccaatgcctcctacagatccttatcggcagccactg
cccccactcaccctacccacgagcccacagactgctatcagcatgtattccaatatgcct
cattctcccgctgtggctcctggatgccctctagtacccatgcatggtgagggtttacta
cagatagctccatcccatcctcagcaaatggtgtccacatctcctccttccacaccgagc
cagaactcccataaaaatggctatccttccccctcaaagcagcctttccatgctgcgtgg
acggggagcagcacagccgtatataccccgaaccctgggggacagcagaatggtagagga
aaccagcaacctccacttcatcacccaaacaactactggccccttcaccagagctcccct
cagtatcagcaccccgtttccaaccacccaggcccagagttctggtgctccgttgcctat
ttcgagatggatgttcaagttggagagatatttaaagtgctatctaattgttccgtggtc
acagtggatggttatgtggacccctctggtggggatcggttttgccttggtcagctttct
aacgtgcatcggacagacactagtgagcgtgcaaggcttcacattggaaagggagtgcag
cttgagtgtcggggcgagggagacgtatggatgaggtgcctcagtgatcacgcagtgttt
gtccagagttattatttggacagggaagcaggacgagcgccaggggatgcagtgcacaag
atttatccgggcgcctacattaaggtgtttgacttacgacagtgtcatcggcagatgcag
cagcaggcggctacggctcaagcagcggctgcagcccaggcggcggctgtagccggcaca
atccctggtcccgggtcagtggggggcatcgctcctgctgtcagcttatctgctgcggcc
ggtatcggggtggatgacctacggcgactctgtatcttgcgccttagttttgtaaagggg
tggggtcccgattaccctcggcagagcatcaagcagaccccctgctggatcgaggtccat
cttcatcgagccctgcagcttttggatgaagttctccatacgttgccaatggcagacccc
agttctgtcaactaa

KEGG   Xenopus laevis (African clawed frog): 108707339
Entry
108707339         CDS       T01010                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108707339
   04350 TGF-beta signaling pathway
    108707339
   04371 Apelin signaling pathway
    108707339
   04068 FoxO signaling pathway
    108707339
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108707339
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108707339
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 108707339
NCBI-ProteinID: XP_018100083
UniProt: A0A1L8HRY9
LinkDB
Position
1S
AA seq 549 aa
MSIANTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLQSSAPSSLLVKDEYGHDYAEVQQSISAGDGHSIQT
IQHPPSSRSSAETYNNPSLLAPSEPSTPNPTSFSSIPVPSTSQSVSLLAATHNDGLLSIA
PVPPQGTQNGFSAQPATYHHNSTTTWTGSRTAAYTPNMSHHPNGHLQHHPPMPHPGHYWP
VHNELAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPASCPIVTVDGYVDPSGGDRFC
LGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPG
DAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAIS
LSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM
PIADPQPLD
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtccatcgcaaacacccccacgagtaacgacgcttgcttgagcatcgtgcacagtctg
atgtgccatcggcaaggaggggagagcgagacatttgccaagcgggccattgagagcctg
gtgaaaaagctgaaggagaagaaggatgaactggattcattgatcacagccataaccacc
aacggggcacaccccagtaaatgtgtcactattcagaggacattagatgggcggctgcag
gttgccggtagaaaaggcttcccgcatgtcatctatgcacgcctgtggaggtggccagac
cttcacaagaatgaactgaagcatgtgaagtactgtcaatatgcttttgatctgaaatgt
gacagtgtctgtgtgaatccctaccactacgagcgtgtcgtatcccctggaatagatctt
tcggggctgacgctgcagagttctgccccatccagcttattggtaaaggatgaatatggc
catgactatgctgaagtacagcagtccatttctgcaggggacggacattcaattcagacc
attcagcacccaccaagcagcaggtcctccgctgaaacttataacaacccatccctgctg
gcacccagtgaacccagcacacccaatcccaccagtttctccagcattccagttccatca
acaagccaatcagtgagtttactggcagcgactcacaacgatggactgctctccattgct
cctgtacctccacaagggacgcaaaatggcttcagcgctcagccagcaacatatcatcat
aacagtactacaacctggactggaagtagaacagcagcttacacacctaatatgtctcac
catccgaacggacatcttcagcatcacccacccatgccccatcctggacattactggcct
gttcataatgaacttgcatttcagccaccaatctcaaatcaccccgctcctgattattgg
tgctccattgcctactttgaaatggacgttcaagtgggagagacctttaaagttcccgca
agctgtcccatcgtcacagttgatggttatgtggacccatctgggggtgatcggttttgt
ttaggccagctttccaatgttcacagaacagaagccattgagagggcaaggttacatata
ggaaaaggtgttcagctggaatgtaaaggagagggcgatgtctgggttcgctgtctcagt
gatcacgcagtgtttgtccagagctactacctagacagagaagctggaagggcaccaggg
gatgctgtgcacaaaatttatcccagcgcatatattaaggtgtttgatttacgccagtgc
caccggcaaatgcaacaacaagctgcaaccgcacaagcagcagctgcagcgcaagcagcc
gccgtggcaggcaacatcccaggacccgggtctgtggggggaatagccccggctattagt
ctgtcagcggcagcaggaatcggagtggatgatttgcgcaggctgtgtatcttgaggatg
agttttgttaaaggctggggacccgattacccgcggcagagcattaaggagaccccctgc
tggatagaaattcacctgcaccgcgctctgcagctgctggacgaagtcctccacacaatg
cccattgctgatccacagcctctggactga

KEGG   Xenopus laevis (African clawed frog): 403356
Entry
403356            CDS       T01010                                 

Gene name
smad4.2.L, Smad4b, Smad4beta, XSmad4alpha, XSmad4beta, dpc4, jip, madh4, smad10, smad4.2, smad4.2-a, smad4.2-b, xsmad4, xsmad4b
Definition
(RefSeq) SMAD family member 4, gene 2 L homeolog
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    403356 (smad4.2.L)
   04350 TGF-beta signaling pathway
    403356 (smad4.2.L)
   04371 Apelin signaling pathway
    403356 (smad4.2.L)
   04068 FoxO signaling pathway
    403356 (smad4.2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    403356 (smad4.2.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    403356 (smad4.2.L)
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 403356
NCBI-ProteinID: NP_001084387
Xenbase: XB-GENE-5995204
UniProt: Q9PWJ9
LinkDB
Position
8L
AA seq 560 aa
MSLTPPNSSDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
SVCVNPYHYERVVSPGIGLSIPSTVTTPCRSVKEEYVHECEMDASSCLPASQELPPAIKH
ASLPPMPPTESYRQPLPPLTLPKSPQTAISMYPNMPLSPSVAPGCPLIPMHGEGLLQIAP
SHPQQMLSISPPSTPSQNSQQNGYSSPPKQPFHASWTGSSTAVYTPNPGVQQNGRGNQQP
PLHHPNNYWPLHQSSPQYQHPVSNHPGPEFWCSVAYFEMDVQVGEIFKVPSNCPVVTVDG
YVDPSGGDRFCLGQLSNVHRTDTSERARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQSY
YLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGAIPGP
GSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKQTPCWIEVHLHRA
LQLLDEVLHTLPMADPSSVN
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtctctgacccctcctaacagcagtgatgcctgtctcagcatcgtacacagtctcatg
tgccaccggcaggggggggagaacgagggctttgccaagagagccattgagagtctcgtc
aagaaactgaaggagaagaaagacgagctggactccctcatcactgccattactactaat
ggagtgcaccccagcaagtgcgttaccatccagcgaaccttggacgggaggcttcaggta
gccggccgtaaaggtttcccacatgtgatctacgctcgtttgtggcgctggccggacctg
cacaagaatgagctgaaacacgttaagttctgccagttcgccttcgacctgaagtacgac
agcgtgtgcgtgaacccctatcactacgagcgggtggtttctcccggcattggtctgagt
atccctagcactgtgaccaccccatgccggtcagtaaaagaggagtatgtccatgagtgt
gaaatggatgcatcttcatgtctcccagcatcccaggaacttccgccagccatcaaacat
gcctcccttccaccaatgcctcctacagagtcctacaggcagccactgcccccactcacc
ctacccaagagcccccagactgctatcagcatgtatcccaacatgcccctctctccctct
gtggctcctggttgccctctcatacctatgcatggtgaggggttactacagatagctcca
tcccatccccagcaaatgttgtccatatctccgccttccacaccgagccagaactcccag
cagaatggttattcttcccccccaaagcagcctttccatgcttcttggacagggagcagc
acagctgtatataccccgaaccctggggtacagcagaacggaagaggaaaccagcaacct
ccacttcaccacccaaacaactactggccccttcaccagagctcccctcagtatcagcac
cccgtgtcaaaccacccaggcccagagttctggtgctccgttgcctatttcgagatggat
gttcaggttggggagatatttaaagtcccatctaactgtcccgtggtcacggtggatgga
tatgtggacccctctggtggggatcggttttgccttggtcagctttctaacgtgcatcgc
acagacactagtgagcgtgcaaggcttcacatcgggaagggagtgcagcttgagtgtcgg
ggcgagggagacgtatggatgaggtgcctcagtgatcacgccgtgtttgttcagagttat
tacttggacagggaagcagggcgagcgccgggagatgcagtccacaagatttatccgggc
gcctacattaaggtgtttgacttgcgacagtgtcaccggcagatgcagcagcaggcggct
acggctcaagcagcggctgcagcccaagcggcggctgtggccggcgcaatccctggtccc
gggtcagtggggggcatcgctcctgctgtcagtctttctgctgcggccggtatcggggtg
gacgacctacggcgcctctgtatcttgcgccttagttttgtgaagggctggggccctgat
taccctcggcagagcatcaagcagactccctgctggatcgaggtccatcttcaccgtgcg
ctgcagcttcttgatgaagttctccatactttgccaatggcagaccccagttctgtcaac
taa

KEGG   Xenopus laevis (African clawed frog): 403398
Entry
403398            CDS       T01010                                 

Gene name
smad4.2.S, Smad4b, Smad4beta, XSmad4alpha, XSmad4b, XSmad4beta, dpc4, jip, jv5-1, madh4, madh5, smad10, smad4.2-a, smad4.2-b, smad5, xsmad4
Definition
(RefSeq) SMAD family member 4, gene 2 S homeolog
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    403398 (smad4.2.S)
   04350 TGF-beta signaling pathway
    403398 (smad4.2.S)
   04371 Apelin signaling pathway
    403398 (smad4.2.S)
   04068 FoxO signaling pathway
    403398 (smad4.2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    403398 (smad4.2.S)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    403398 (smad4.2.S)
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 403398
NCBI-ProteinID: NP_001084458
Xenbase: XB-GENE-6256010
UniProt: Q9YGP9
LinkDB
AA seq 595 aa
MAFASLELALHRVPPARCGDEEIYGEGLSEGEIPAMSLTPPNSSDACLSIVHSLMCHRQG
GENEGFAKRAIESLVKKLKEKKDELDSLITAITTNGVHPSKCVTIQRTLDGRLQVAGRKG
FPHVIYARLWHWPDLHKNELKHVKFCQFAFDLKYDSVCVNPYHYERVVSPGIGLSIPSTV
TTPCRSVKEEYVHECEMDASSCLPASQELPPAIKHASLPPMPPTESYRQPLPPLTLPKSP
QTAISMYPNMPLSPSVAPGCPLIPMHGEGLLQIAPSHPQQMLSISPPSTPSQNSQQNGYS
SPPKQPFHASWTGSSTAVYTPNPGVQQNGKGNQQPPLHHANNYWPLHQSSPQYQHPVSNH
PGPEFWCSVAYFEMDVQVGEIFKVPSNCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDTSE
RARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKV
FDLRQCHRQMQQQAATAQAAAAAQAAAVAGAIPGPGSVGGIAPAVSLSAAAGIGVDDLRR
LCILRLSFVKGWGPDYPRQSIKQTPCWIEVHLHRALQLLDEVLHTLPMADPSSVN
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggcgtttgccagcctagagctcgccctgcaccgagtgccccccgcccggtgtggagat
gaggagatctacggggaaggcttgtctgagggggagatcccggccatgtctctgacccct
cctaacagcagtgatgcctgtctcagcatcgtacacagtctcatgtgccaccggcagggg
ggggagaacgagggctttgccaagagagccattgagagtctcgtcaagaaactgaaggag
aagaaagacgagctggactccctcatcactgccattactactaatggagtgcaccccagc
aagtgcgttaccatccagcgaaccttggacgggaggcttcaggtagccggccgtaaaggt
ttcccacatgtgatctacgctcgtttgtggcactggccggacctgcacaagaatgagctg
aaacacgttaagttctgccagttcgccttcgacctgaagtacgacagcgtgtgcgtgaac
ccctatcactacgagcgggtggtttctcccggcattggtctgagtatccctagcactgtg
accaccccatgccggtcagtaaaagaggagtatgtccatgagtgtgaaatggatgcatct
tcatgtctcccagcatcccaggaacttccgccagccatcaaacatgcctcccttccacca
atgcctcctacagagtcctacaggcagccactgcccccactcaccctacccaagagcccc
cagactgctatcagcatgtatcccaacatgcccctctctccctctgtggctcctggttgc
cctctcatacctatgcatggtgaggggttactacagatagctccatcccatccccagcaa
atgttgtccatatctccgccttccacaccgagccagaactcccagcagaatggttattct
tcccccccaaagcagcctttccatgcttcttggacagggagcagcacagctgtatatacc
ccgaaccctggggtacagcagaacggaaaaggaaaccagcaacctccacttcaccacgcc
aacaactactggccccttcaccagagctcccctcagtatcagcaccccgtgtcaaaccac
ccaggcccagagttctggtgctccgttgcctatttcgagatggatgttcaggttggggag
atatttaaagtcccatctaactgtcccgtggtcacggtggatggatatgtggacccctct
ggtggggatcggttttgccttggtcagctttctaacgtgcatcgcacagacactagtgag
cgtgcaaggcttcacatcgggaagggagtgcagcttgagtgtcggggcgagggagacgta
tggatgaggtgcctcagtgatcacgccgtgtttgttcagagttattacttggacagggaa
gcagggcgagcgccgggagatgcagtccacaagatttatccaggcgcctacattaaggtg
tttgacttgcgacagtgtcaccggcagatgcagcagcaggcggctacggctcaagcagcg
gctgcagcccaagcggcggctgtggccggcgcaatccctggtcccgggtcggtggggggc
atcgctcctgctgtcagtctttctgctgcggccggtatcggggtggacgacctacggcgc
ctctgtatcttgcgccttagttttgtgaagggctggggccctgattaccctcggcagagc
atcaagcagactccctgctggatcgaggtccatcttcaccgtgcgctgcagcttcttgat
gaagttctccatactttgccaatggcagaccccagttctgtcaactaa

KEGG   Xenopus laevis (African clawed frog): 779167
Entry
779167            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC79910
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    779167
   04350 TGF-beta signaling pathway
    779167
   04371 Apelin signaling pathway
    779167
   04068 FoxO signaling pathway
    779167
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    779167
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    779167
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 779167
NCBI-ProteinID: NP_001090261
UniProt: Q9W639
LinkDB
AA seq 549 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLQSSAPSGLLVKDEYGHDYAEGQQSISAGDGLSIQT
IQHPPSSRSSTETYSNPALLVPSEPSTPNPTSFSSIPVPSTSQPASLLAATHNDGLLSIA
PVPPQGTQNGFSAQPATYHHNSTTTWTGSRTAAYTPNMSHHPNGHLQHHPPMPHPGHYWP
VHNELAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFC
LGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPG
DAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAIS
LSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM
PIADPQPLD
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtccatcacaaacacccccacaagtaacgatgcttgcttgagcatagtgcacagtctc
atgtgccatcggcaaggaggggagagcgagacttttgctaagcgggccattgagagcctg
gtcaaaaagctgaaggagaagaaggatgaactggattcactgataacggccataaccacc
aatggtgcgcaccccagtaaatgtgtcactattcagaggacgttagatggccggctgcag
gttgccggtagaaaaggcttcccccatgtcatctatgctcgcctttggaggtggccagac
cttcacaagaatgaactgaagcatgtgaagtactgtcagtatgcttttgatctaaaatgt
gacagtgtttgtgtcaatccttaccactacgaacgagttgtatcccctggaatagatctt
tcaggactgacgctgcagagttctgccccatccggcttgttggtgaaggatgaatatggc
cacgactatgcggaagggcagcagtcaatttctgcaggagatggactttcaattcagacc
atccagcacccaccaagcagcaggtcctccactgaaacttatagcaacccagccctgttg
gtaccgagtgaacccagcacacccaatcccaccagtttctcaagcattcctgtcccatca
acaagtcaaccagcaagtttactggcagcaactcacaacgatgggctgctctccatcgct
cctgtgcctccccaagggacacaaaatggcttcagtgctcagccagcaacatatcatcat
aacagtactacaacctggactggaagtagaacagcagcttacacacctaatatgtctcac
catccgaacggacatcttcagcatcacccacccatgccccatcctggacattactggcct
gtccataatgagcttgcatttcagccaccaatctcaaatcacccggctcctgattattgg
tgctccattgcctactttgaaatggatgttcaagtgggagagacctttaaagttccctca
agctgtcccatcgtcactgttgatggatacgtggacccatctgggggtgatcggttttgc
ttaggccagctttccaatgttcacagaacagaagccatcgagagggcaaggttacatata
ggaaaaggtgtgcagctggaatgtaaaggagaaggggatgtctgggttcgctgtctcagt
gatcatgcagtgtttgtccagagctattacttggacagagaagctggaagggcaccaggg
gatgccgtgcacaaaatttatcccagcgcatatattaaggtgtttgatttacgccagtgt
caccgacagatgcagcaacaggccgcaaccgcacaagcagcagccgcagctcaagcagcc
gcagtggcaggcaacatcccaggaccaggctccgtggggggaatagccccggctatcagt
ctatcagcggcagcaggaatcggcgtggatgatttgcgtagactctgtatcttgaggatg
agtttcgttaaaggttggggtcccgattacccgcggcagagcattaaggagaccccctgc
tggatcgaaatccacttgcaccgcgctctgcagctgttggacgaagtcctccacactatg
cctattgctgatcctcagcctctggactga

KEGG   Xenopus laevis (African clawed frog): 780764
Entry
780764            CDS       T01010                                 

Gene name
smad4.1.L, XSmad4alpha, Xsmad4, dpc4, jip, madh4, smad4, smad4.1, smad4a, smad4alpha, xsmad4a
Definition
(RefSeq) SMAD family member 4, gene 1 L homeolog
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    780764 (smad4.1.L)
   04350 TGF-beta signaling pathway
    780764 (smad4.1.L)
   04371 Apelin signaling pathway
    780764 (smad4.1.L)
   04068 FoxO signaling pathway
    780764 (smad4.1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    780764 (smad4.1.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    780764 (smad4.1.L)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 780764
NCBI-ProteinID: NP_001090536
Xenbase: XB-GENE-865543
UniProt: Q9W639
LinkDB
Position
1L
AA seq 549 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLQSSAPSGLLVKDEYGHDYAEGQQSISAGDGLSIQT
IQHPPSSRSSTETYSNPALLVPSEPSTPNPTSFSSIPVPSTSQPASLLAATHNDGLLSIA
PVPPQGTQNGFSAQPATYHHNSTTTWTGSRTAAYTPNMSHHPNGHLQHHPPMPHPGHYWP
VHNELAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFC
LGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPG
DAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAIS
LSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM
PIADPQPLD
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtccatcacaaacacccccacaagtaacgatgcttgcttgagcatcgtgcacagtctc
atgtgccatcggcaaggaggggagagcgagacttttgctaagcgggccattgagagcctg
gtcaaaaagctgaaggagaagaaggatgaactggattcactgataacggccataaccacc
aatggtgcgcaccccagtaaatgtgtcactattcagaggacgttagatggccggctgcag
gttgccggtagaaaaggcttcccccatgtcatctatgctcgcctttggaggtggccagac
cttcacaagaatgaactgaagcatgtgaagtactgtcagtatgcttttgatctaaaatgt
gacagtgtttgtgtcaatccttaccactacgaacgagttgtatcccctggaatagatctt
tcaggactgacgctgcagagttctgccccatccggcttgttggtgaaggatgaatatggc
cacgactatgcggaagggcagcagtcaatttctgcaggagatggactttcaattcagacc
atccagcacccaccaagcagcaggtcctccactgaaacttatagcaacccagccctgttg
gtaccgagtgaacccagcacacccaatcccaccagtttctccagcattcctgtcccatca
acaagtcaaccagcaagtttactggcagcaactcacaacgatgggctgctctccatcgct
cctgtgcctccccaagggacacaaaatggcttcagtgctcagccagcaacatatcatcat
aacagtactacaacctggactggaagtagaacagcagcttacacacctaatatgtctcac
catccgaacggacatcttcagcatcacccacccatgccccatcctggacattactggcct
gtccataatgagcttgcatttcagccaccaatctcaaatcacccggctcctgattattgg
tgctccattgcctactttgaaatggatgttcaagtgggagagacctttaaagttccctca
agctgtcccatcgtcactgttgatggatatgtggacccatctgggggtgatcggttttgc
ttaggccagctttccaatgttcacagaacagaagccatcgagagggcaaggttacatata
ggaaaaggtgtgcagctggaatgtaaaggagaaggggatgtctgggttcgctgtctcagt
gatcatgcagtgtttgtccagagctattacttggacagagaagctggaagggcaccaggg
gatgccgtgcacaaaatttatcccagcgcatatattaaggtgtttgatttacgccagtgt
caccgacagatgcagcaacaagccgcaaccgcacaagcagcagccgcagctcaagcagcc
gcagtggcaggcaacatcccaggaccaggctccgtggggggaatagccccggctatcagt
ctatcagcggcagcaggaatcggcgtggatgatttgcgtagactctgtatcttgaggatg
agtttcgttaaaggttggggtcccgattacccgcggcagagcattaaggagaccccctgc
tggatcgaaatccacttgcaccgcgctctgcagctgttggacgaagtcctccacactatg
cctattgctgatcctcagcctctggactga

DBGET integrated database retrieval system