KEGG   Xenopus laevis (African clawed frog): 108700971
Entry
108700971         CDS       T01010                                 

Definition
(RefSeq) apoptosis regulator R11-like
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04210  Apoptosis
xla04621  NOD-like receptor signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108700971
   04137 Mitophagy - animal
    108700971
  09143 Cell growth and death
   04210 Apoptosis
    108700971
   04115 p53 signaling pathway
    108700971
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108700971
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108700971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108700971
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108700971
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    108700971
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108700971
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108700971
Transporters [BR:xla02000]
 Other transporters
  Pores ion channels [TC:1]
   108700971
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 SQHop_cyclase_C
Other DBs
NCBI-GeneID: 108700971
NCBI-ProteinID: XP_018090534
LinkDB
Position
9_10L
AA seq 188 aa
MEGSSRDLVEKFVGKKLFQKGACRKFSNNSQPKAVSNGTSEGPGKGASQGIVGEVVLQAL
LEASEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVVGELFRDGTNWGRIMAFFSFGRAL
CVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWGNLLNSAILVNQCREGCNEFRE
SIGFIRPY
NT seq 567 nt   +upstreamnt  +downstreamnt
atggagggcagcagtagagatctggtggagaagtttgttggaaagaaacttttccagaaa
ggagcatgcaggaagttctcaaataactcccaacctaaagctgtatctaatggaacttca
gagggccctgggaaaggggcttcacagggcattgtgggggaggtagtccttcaggccctg
ttggaagcatcggaggaatttgaattgagatatcagcgtgccttcagtgacctgacctca
cagctgcacatcacccaggacacagcgcagcagagcttccagcaggttgtgggagagttg
ttcagggatggcacaaactgggggagaattatggctttcttctcatttgggcgggccctg
tgtgtggagagtgcaaacaaggagatgactgatctgctacccagaattgtccagtggatg
gtgaattatctagagcacacactacagccctggatgcaggagaacggaggctggggaaat
ctgttaaactctgcgatattggtaaaccaatgcagagaagggtgcaatgagtttagagaa
tcaataggcttcatacggccatactag

KEGG   Xenopus laevis (African clawed frog): 398251
Entry
398251            CDS       T01010                                 

Gene name
bcl2l1.L, bcl-XL, bcl-x(l), bcl2l1, bclxl, xR11
Definition
(RefSeq) BCL2-like 1 L homeolog
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04210  Apoptosis
xla04621  NOD-like receptor signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    398251 (bcl2l1.L)
   04137 Mitophagy - animal
    398251 (bcl2l1.L)
  09143 Cell growth and death
   04210 Apoptosis
    398251 (bcl2l1.L)
   04115 p53 signaling pathway
    398251 (bcl2l1.L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    398251 (bcl2l1.L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    398251 (bcl2l1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    398251 (bcl2l1.L)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    398251 (bcl2l1.L)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    398251 (bcl2l1.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     398251 (bcl2l1.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    398251 (bcl2l1.L)
Transporters [BR:xla02000]
 Other transporters
  Pores ion channels [TC:1]
   398251 (bcl2l1.L)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Smoothelin KASH_CCD
Other DBs
NCBI-GeneID: 398251
NCBI-ProteinID: NP_001082147
Xenbase: XB-GENE-6251803
UniProt: Q2TAP5
LinkDB
Position
9_10S
AA seq 204 aa
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQ
ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR
ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE
RFGRLLTIVILTGVFALVCYMRRR
NT seq 615 nt   +upstreamnt  +downstreamnt
atggagggcagcagtagagatctggtggagaagtttgttagtaagaaactttcccagaat
gaagcctgcaggaagttctccaataatccccaacccaatgccatatctaatggaacttct
acttcagagcgccccggggaaggggccacgcagggcattgtggaggaggaagtccttcaa
gcccttttggaagcaacggaggagtttgagttgagatatcagcgtgccttcagtgacctg
acctcacagctgcacatcacccaggacacggcccagcagagcttccagcaagttatggga
gagttgttcagggatgggacaaactgggggagaattgtggctttcttctcatttgggcgg
gccctatgtgtggagagtgcaaacaaggagatgactgatctgctacccagaattgtccag
tggatggtgaattatctagagcacacactgcagccctggatgcaggagaatggaggctgg
gaagcttttgtcggcctgtatggaaagaatgccgcagcccagagcagagaaagccaggaa
cgatttggcaggttgctgactatagtgattctgactggtgttttcgcattggtctgctac
atgaggcgccgatag

DBGET integrated database retrieval system