KEGG   Xenopus laevis (African clawed frog): 108701235
Entry
108701235         CDS       T01010                                 

Gene name
steap3.L, dudlin-2, tmp3, tsap6
Definition
(RefSeq) STEAP3 metalloreductase L homeolog
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    108701235 (steap3.L)
   04115 p53 signaling pathway
    108701235 (steap3.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108701235 (steap3.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     108701235 (steap3.L)
Membrane trafficking [BR:xla04131]
 Exocytosis
  Others
   Others
    108701235 (steap3.L)
SSDB
Motif
Pfam: Ferric_reduct F420_oxidored 2-Hacid_dh_C NAD_binding_2 Shikimate_DH IlvN
Other DBs
NCBI-GeneID: 108701235
NCBI-ProteinID: XP_018091079
Xenbase: XB-GENE-17331071
UniProt: A0A1L8EV53
LinkDB
Position
9_10L
AA seq 509 aa
MCPSPTAPPLCCPLTSRYKSQADRDMPESDMARPLLERDNSVGPWGSCSGGTIGILGTGD
FARSLATRLLCSGFKVVVGSRNPKRNVGIFPAEAELMSQEEAVKRVELVFVALYKEHYST
LRSLAGALSRKILIDISNNQEVNTKGESNAEYLASLFPHSTVVKGFNVVSAWALQSGPKD
GNKQVLLCSNCPEARSHVAGIARSMGFIPVDMGSLCSAREIENIPLRLLPFWKVPVVLAL
CLFLFFYLYNFVRSVLHPYLIENKNKFYKIPIDLVNVTLPCVSYVLLSMVYLPGILAAFY
QLHRGTKYQRFPDWLDQWMIHRKQIGLVSFFCACLHAIYSLCLPMRRSARYLLINDAVKQ
VKDGGADAWVEEQVWRMEIYVSFGIMALGVLSLLAITSLPSISNSLNWREFNFIQSQLGL
VALLISTLHTLTFGWKRAFDGNFYKFYLPPTFTLTLVVPGAIILARVTLLLPCIHRRLMK
IRRGWERRSSFQIMMTNCTEEMAESSSNV
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtgcccctcccctactgctcctcccctttgctgccccctcacttcccggtacaagtcc
caggcagacagagatatgccggagtcagacatggccaggcctctgttggagagggataat
agcgttggaccctggggctcctgttctggagggaccattggaatattgggcaccggggat
tttgctcgctcactggccactcgcctcctgtgctctgggtttaaggtggtggttgggagc
aggaacccaaagcgcaatgtaggaatttttcctgctgaggcagagttgatgtctcaggag
gaggcagtgaaaagggtggagctggtgtttgtggccctatacaaggaacattattccacc
ctgagaagtctggcaggggccctctcacgtaagatcctcattgacatcagtaataaccag
gaagtgaacacaaagggagaatccaatgccgagtaccttgcctccctcttccctcacagc
acagtggtgaagggcttcaacgtggtgtcagcgtgggccctgcagtctggacccaaagat
gggaacaagcaggttctgctctgttccaattgccctgaagcaaggagccatgtggctggc
attgcccggagcatgggcttcatccctgtagatatgggaagcctttgttctgctagggag
attgagaacattcccctccggctcctgccattttggaaagttccagtggttctggcactc
tgcctcttcctgttcttctacctgtacaattttgtgcgttccgtgctgcacccctacttg
atagagaacaagaacaagttctacaagatccctattgatctggttaacgttaccctccct
tgtgtctcctatgtactcctgtccatggtatatctgccaggaatcctggctgccttctac
caactgcacagaggcaccaagtaccagcgcttcccagattggctggatcagtggatgatt
cacagaaagcagataggattagtcagtttcttctgtgcctgcctacatgccatttatagc
ctgtgcctccccatgcgcaggtctgcacgctacctcctcattaacgacgctgtgaaacag
gtcaaggatggaggagcagatgcctgggtggaagagcaggtatggcggatggagatatac
gtgtcttttgggatcatggcgcttggggtgctctctctgctggctattacctccctgccc
tccatctctaactcactcaactggagagaattcaacttcatccagtctcagctgggattg
gtggcgctgctcattagcacactgcacacgctgacttttggctggaagcgagcctttgat
ggcaatttctacaagttctacttgccgcccactttcactctcaccctcgtggtgcccggt
gccattatcctggccagagttaccctcctcctgccctgcatccaccggaggctgatgaag
atccgcaggggctgggagaggaggagctcattccagatcatgatgacaaattgtacagag
gaaatggcagaaagttccagcaatgtttaa

DBGET integrated database retrieval system