KEGG   Xenopus laevis (African clawed frog): 108701411Help
Entry
108701411         CDS       T01010                                 

Gene name
hdac4.L
Definition
(RefSeq) histone deacetylase 4 L homeolog
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108701411 (hdac4.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108701411 (hdac4.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108701411 (hdac4.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108701411 (hdac4.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108701411
NCBI-ProteinID: XP_018091526
Xenbase: XB-GENE-17335610
LinkDB All DBs
Position
9_10L
AA seq 1075 aa AA seqDB search
MLVHNQVISVCNPATDDGISGLDQPVDLLTQTRAKHMPSTVDVSAPLPLQVAPSVLPMDL
RLDPQYSISAQEPSGREQQLQQELLVLKQKQQIQRQLLIAEFQRQHEQLSRQHEAQLHEH
IKQQQELLAMKHQQELLEHQRKLEQHRQEQEMEKQQREQKLLLLKNKEKGKESAVASTEV
KMKLQEFVLNKKKALAHRSLNHCMSSDPRLWKTQHSSLDQSPPPQGVVSASYHQAVLGMY
DSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPGVTTLKKRPLDVSDSVCN
SAPGSGPSSPNNSSSNISSENGIAGPLGIQTEASLAHRLLNRENSVTQLPLYTSPSLPNI
TLGLPASGSTNGASGQENECLPLPALQQRLSLFPAAHLSSYLGPEATNSHNQLLQHMVLL
EQPGAQSSLISGLGTLPLHSQSLVSPDRVSPTMHKLRQHRPLGRTQSAPLPQNSHALQHL
VIQQQHQQFLEKHKQQFQQQQLHLNKMIPKVNEASRQHESHPEETEEELREHQALHEETY
VERLAEQKELSPGNVVHVKQEKEESDDEENTLDLERSKMQSDPDLLFRQQTLLLEQQRIH
QLRNYQASLEAAGLVAPFSGHRPLSRAQSSPASASFPMSVQEVPSKPRFTTGLVYDTLML
KHQCICGNTNSHPEHAGRIQSIWSRLQETGLRSMCECIRGRKATLEELQTVHSEAHTLLY
GTNPLNRQKLEGSLASLFVRLSCGGVGVDSDTIWNEVHSSGAARLAVGCVVELASNVVTG
ELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKVLQQRLNVEKTLIVDWDVHHGNGTQ
QAFYSDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGDAEYL
AAFRTVVMPIAAKFSPDVVLVSAGFDAGEGHPSPLGGYRVSAKCFGYLTKQLMEIAGGRI
VLALEGGHDLTAICDASEACVSALLGNKLEPLPESVLQQRPNINAVRSMEKVIQIQSEYW
PCLHISSSTVSYSLIEAQKCENEEAETVTAMASLSVDVRQEQRTEDEPMDEEPPL
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgttggttcataaccaagttatttctgtttgtaaccctgctactgatgatggaatttct
ggtctggaccaaccagtggaccttttaacacagacccgtgccaaacacatgccaagcact
gttgatgtgagtgctccactgccgctgcaagtggcccccagtgttctacccatggacctg
cggctagacccccaatattcaatttcggcacaggagcccagtgggagggagcaacagctg
cagcaagagctcctggtcttgaagcagaagcagcagatccaaaggcagcttttgattgct
gagtttcaaagacagcatgaacagctgtcccgccagcatgaagctcagctccatgagcat
ataaagcagcaacaagagctcctggctatgaaacatcagcaggagcttctggaacaccag
agaaagctggagcagcaccgacaagagcaggagatggagaaacagcaacgagaacagaaa
ttactgctgttaaagaacaaggaaaaaggaaaagaaagcgctgtggcaagcactgaggtc
aaaatgaaattacaagagtttgtgttgaataagaagaaagctttagctcacaggagctta
aatcattgcatgtccagtgatcctcggctctggaaaactcagcatagctctcttgaccag
agtcctccaccacagggtgttgtgtccgcctcatatcaccaagctgtccttggaatgtac
gactctaaggatgacttccctttgagaaaaacagcatctgagcctaatctgaagttgcgc
tcaaggctgaaacagaaagttgctgagaggaggagtagccctctactacggaggaaagat
ggtcctggtgtcactaccttgaaaaaacgtcctttagatgtatctgattctgtatgtaac
agtgctccaggctctggtcccagttctcccaataatagttcaagcaacatcagttcagaa
aatggaatagctggtcctttaggaatccagacagaggcttcactggctcacagacttttg
aacagggagaattcagtaacacagctccctctatacacatcaccatctttacccaatatt
accctaggactgcctgcaagtggttctaccaacggtgcatcaggacaagagaatgaatgc
cttcctctgcctgcactacaacaacgcctttccctctttccagctgctcacctctcttct
taccttggacctgaggccacaaactctcataatcaacttttacagcatatggtactacta
gaacagcctggtgcacagagttctttaatatcgggtttggggaccctgccacttcactct
cagtctcttgtgtcacctgatcgtgtatcccccacaatgcacaagttacgtcagcaccgt
cctttaggccgtactcagtctgctccacttccacagaattcacatgctctgcaacacctg
gtcatccaacaacagcaccagcaattcctggaaaagcacaaacagcaatttcaacagcag
cagcttcacctaaacaagatgattcctaaagtgaatgaagcctcacggcagcatgagagc
caccctgaggagactgaggaggagttacgtgagcatcaggcgctgcatgaagaaacttat
gtagagcgtttagctgaacagaaggaactaagccctggcaatgtggtgcatgtgaagcag
gaaaaagaggaaagcgatgatgaagaaaatacactggatttggaacggagtaaaatgcag
tctgacccagacctgctgttcagacagcaaacattattactggagcaacagcgcattcat
caactgagaaactatcaggcttccctagaggctgcaggcttagttgcaccattcagtggg
catcggcctctctcgagagcgcagtcctcacctgcctctgcatcctttcccatgtctgta
caggaggtccccagtaaacccaggttcaccacaggccttgtgtatgatacattgatgtta
aaacaccagtgcatatgtggaaacacaaacagtcatcctgagcatgctggcagaatacaa
agcatttggtcaaggcttcaagaaacaggcttacgaagcatgtgtgagtgtattcggggg
agaaaggcaacactggaagaactacagactgtgcattctgaggctcatactctcttatat
ggcaccaatcccttgaaccgtcaaaagcttgaaggttctttggcttctctcttcgtccgt
ctctcatgtggcggggttggggttgatagtgacacgatttggaatgaagtacactcttcc
ggggctgcccgtcttgcagttggttgtgtagttgaactggcttccaatgtggttactgga
gagctgaagaatggctttgctgtggttcgtcctcctggccaccatgcagaagaaagcaca
cctatggggttctgttacttcaactctgtagcaatagctgccaaagttctccagcaacga
ttaaatgtcgagaagacgctgattgtggactgggatgttcaccatgggaatggtacccaa
caggcattttacagtgatccaaacgtcctttatatatcacttcatcgctatgatgatggt
aacttttttccagggagcggagccccagatgaggttggaacaggtgctggtgtgggtttc
aatgtgaacatggcttttactggtggtctggaccctcccatgggtgatgcagaatatctg
gcagctttcaggacagttgtgatgccaatagctgctaagttttctccagatgtggttttg
gtgtctgctgggtttgatgcaggagaaggacacccatctccgcttggtggttacagagtc
tcagctaaatgttttgggtacctgacaaagcaacttatggaaatagctggagggcgtatt
gtactagctcttgaaggaggccatgatttaacagctatttgtgatgcctcggaagcctgt
gtgtccgccctgctgggaaataagctggaaccacttcctgaatctgtattgcagcagaga
ccaaacatcaatgcagtcaggtcaatggaaaaagttattcagatccaaagtgaatactgg
ccttgtttgcatataagttcctcaactgtgtcctactcacttattgaagctcaaaagtgt
gagaatgaggaggcagagactgtgacagcaatggcatccctgtctgtagatgttcgtcag
gaacaaaggactgaggatgagccaatggatgaagaacctcctctgtag

DBGET integrated database retrieval system