KEGG   Xenopus laevis (African clawed frog): 108701656
Entry
108701656         CDS       T01010                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04218  Cellular senescence
xla04910  Insulin signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    108701656
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108701656
  09143 Cell growth and death
   04115 p53 signaling pathway
    108701656
   04218 Cellular senescence
    108701656
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108701656
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108701656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108701656
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108701656
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Rota_NSP4 Cnd1
Other DBs
NCBI-GeneID: 108701656
NCBI-ProteinID: XP_018092071
LinkDB
Position
9_10L
AA seq 1787 aa
MAKQMGKDPGLKEKVKMLFGLAPSRGKAKPSEWKHPEYVITSELMKELSPESALHIRLRA
INQVCELAKTKKFEEHAVEAICQAVSDLLQPEQPVEGRLHVLHLLKAIILGQGERLGVLR
AHFFRVIKDYPSKEDVAERLEVFKALTDNGREIAYLEEELAAFVLQWMDIGLTPDFLMVL
VNLVKFNSCYLEHFIAPMVQMICLLCNRTTSPYDIEVSLKVLDAVVCYNCLPSESIPIFV
ITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYSMSRIMEDRVHMEDAPLLRGAVFFVG
MGLWGAHRLFCLKNSPISVLPSFLKAMNCNNAVVSYEIVLSVTRLIKKYGKDVQAATWDV
LLDIIERLFQQLQMLRSQELKATVHNLLTTTEELYNQNEFHGDEERFFELVEKGADERPI
ASVVNLITYRAQSIHPGKEGWVMNLQKLMDRYFRNESRSVVRMKVLDVLSFALSINRQFY
EDELIEKVVTCQLAHIPEDKDHQVRKLATQLLVDLAECCHSCHFNSLMDIIEKVVNRSLS
TPESGHDSSSSSSLEDVKTSVLGLMVILQTKLYILPASHAMRVYEMLINHIQLHYKYKYS
SPLASSIRLQVFDFLLHLRADSLRRVGLPNKDGAFRFSPYCLCESTNEQEKRAAERKPAG
TLSPPSGSPSVPSQTVVPRMGFLPFSLAFGVILQCLKQETDWKVLKLVLNKLPECLRYKL
LILSSPCNIDQLAASLCAMLTDKTASDRLYITPDGFSRTDLQLAVVPVLTALTSYHQHLE
LSKQRDMVRCLETGLIFRCGKQCVVALSMCVIEMPSILIKSLPVLIVKLTHISATVTMAI
PMLEFLSTLVRLPHLYANFAAEQYASVFAISLPYTNPSKFNQYIVFLAHHVIAMWFIRCR
LSLRRDFVPYITKGLRSNVLLSFDDTPEKGSFRARSTSLNERPKSLKLSKHTKPGFSDTS
PVKEMRDLSNAFRSRSISVSEHAAYSRMQTSVTSSSLSSADESSMAQADDSLKNLHLELT
EICLDMMARYAFANFTAVPKRSPVGEFLLDGGRTKTWLVGNKLITITTSVGMGTRSLLGL
DTGENHGDPENSSPVQTEQVKEFPSMLDLQQRKPGMQTPRHRVRSMSGGTTLRAGSLEGT
PLSTSIGQPGATPVTRAEKPSRRAQVKKEKTTLADFVPVLTQGWAEVLVRRPTGNTSWLM
SLENPLSPFSSDINNMPLQELSNALMAAERLKEHRETALYKSLSVPASTLSPSTAKTTLL
QRANTESCAVPEEGAQADGEAEEATTPGGSQELEDFEAVVSEDTASEEKTAKKTECISRS
SSTSSQEESAATQTEESEAGGIPIEGSTREVPFQTLSKSSSSPELQALQELPKELVSTED
MKKPAADLKTLPRIETPLSHRTKSEEERSTGALSKPEGGMRLEPELPVLSPHSPTGHRPR
GHTISDSEPSRRGRRIQIDPFKNSTKSSKAEKVPGIDPSFVFLQLYHSPFFGDESNKPIL
VPNTQTFERTMSLLDRIPPYDTHKIGVLYVGEGQIGSERAILSNEHGSYRYTQFLTGLGK
LIELKDTQPDKIFLGGLDGCGDDGQFTYCWHDDIMQVIFQITTLMPNKEIDPNRCNKKRH
VGNNFVNIIYNDSGEFYRLGTLKGQFNFVDVNIQPLECESNLVTLQCRKDMEGLVDTSVA
KIVSDKNLPFLARQMALHSNMASQVHHSRSNPTDIYPSKWIARLRHIKKMRPKIQEELQE
LSASMPYQVPTISNKPPSQNPQTPPGAFETGQRTRLISAVDDFTEFA
NT seq 5364 nt   +upstreamnt  +downstreamnt
atggccaaacagatgggtaaagatcctggcctgaaggaaaaggttaaaatgttatttgga
ctggccccttcacgaggaaaagccaaaccttcagagtggaaacatccggaatatgtcatt
acttcagaattaatgaaggagctgagccctgagtctgctctccacattcgtctccgtgca
attaatcaggtctgtgagcttgcaaagacaaaaaaatttgaagagcacgcagtagaagca
atttgccaagcagtgagtgacttgctgcagcctgaacagccagtagaaggtcgacttcat
gttctgcacttactgaaggccattattttggggcagggtgaaagacttggtgtccttcgt
gcccattttttccgagtcataaaagattatccttcaaaagaggatgttgcagagcgactg
gaagtttttaaagctctaaccgacaatgggcgagaaattgcttatctagaggaagagctt
gctgcctttgtcctccagtggatggatataggtttgactccggatttcttgatggttttg
gttaacctggttaagttcaatagctgttacttggaacactttattgctccaatggtgcag
atgatatgtctcctctgtaatcgtactacatctccttatgatattgaggtttccttgaag
gttctggatgcagtggtctgctataactgccttccatctgagagtatacccatatttgtt
ataaccctgtgccgcacaataaatgttaaggagctgtgtgaaccatgctggaagctcatg
cgaaaccttctgggcacccatctaggtcatagcgccatttattcaatgagtcgtataatg
gaggatagagtccatatggaagatgcccctttgctgagaggagccgtgttctttgttggg
atgggtctctggggagctcacagactgttctgcctgaagaactcgccaatctctgttctc
ccatctttccttaaggctatgaactgtaacaatgccgttgtctcctatgaaattgttctg
tcggtcacacggctaatcaagaagtacggcaaggatgtgcaggctgccacgtgggatgtc
ctcctggatatcatcgagcgcttattccagcagcttcagatgctgcgaagtcaggaatta
aaggctacagtacacaatctcctgaccaccacagaggaactttataaccagaacgaattc
catggagacgaagagagatttttcgagctggttgaaaaaggggcagatgaaagacctatt
gcatcagttgtgaaccttatcacctatagagctcaatccattcaccccgggaaagaaggg
tgggttatgaatctacagaaactaatggacagatatttcaggaatgagtctcgcagtgtt
gtacgcatgaaggtcttggatgttctgtcctttgcactgagcatcaatcgccagttttac
gaggacgagttgattgagaaggtagttacgtgccagctagcccatatacctgaggataag
gaccaccaggtgcgcaaacttgcaacacaactccttgtggacctggctgaatgctgtcac
tcctgccacttcaatagtctcatggacatcattgagaaggtggtgaaccgttctttgtct
acaccagagtcaggtcacgattcttcttcttcttcttctttagaagatgtgaaaacctcc
gttttggggctgatggttattctacagaccaagctatacattctgccagctagccatgcc
atgcgtgtgtacgagatgctgattaatcatatccagcttcactacaaatacaagtacagc
tcaccccttgctagcagtatacgcctccaggtgtttgactttctcctacacctccgagct
gactccttgcggcgtgttgggctacctaacaaagatggtgccttcagattcagtccctat
tgtctctgtgaatccacaaatgaacaagagaagagagcagctgaacgcaagccagcaggc
accttatcaccaccctctggtagccccagtgtcccatcacagactgtcgttccacgcatg
ggtttccttccattctccctagcatttggagttatcctgcagtgcctgaagcaggaaact
gactggaaagtcctgaaactagtcctcaacaagctgcctgaatgtctgcgttacaaactc
ctcatcctttcatcgccctgcaatatagatcaactggctgcctccctctgcgctatgctt
acagacaagactgcaagtgaccgcctttacattactcccgatggcttctctcgtactgat
ctgcagctggcagtggttcctgtgctgactgccttaacttcataccaccaacacctagag
ctctctaaacagagggatatggtgaggtgtctagaaacaggcctgatctttcgctgtggc
aagcagtgtgttgtggcactttccatgtgtgtgatcgagatgccaagcattctaataaag
tctctcccggtcctcatcgtgaagctaacccatatctcggccacggtcaccatggccata
ccaatgctggagtttctgtcaaccttggtccgcctgccccacttgtatgcaaactttgct
gcagagcagtatgccagtgtatttgccatctcccttccatacaccaacccatcaaagttt
aatcaatacattgtattcttggcacaccatgtaattgccatgtggttcatccggtgcaga
ctatcgctgcgcagagactttgtgccatatataacaaagggtttgcgatccaatgtcctg
ctgagctttgatgacacgccagaaaagggcagctttagagctcgcagcaccagtttgaac
gagagacccaaaagcttgaagctatctaaacacacaaagcctggcttcagtgatacgtcc
ccagttaaggagatgagagatctctccaatgccttccgttctcgcagcatcagcgtgtcg
gagcatgctgcatacagccgcatgcagacctctgtcaccagctccagcttgagttcagct
gacgagagctctatggcccaggctgatgacagcctgaaaaatcttcacctggaattgact
gaaatctgcctggatatgatggctcgatacgcctttgccaacttcacggctgtgcccaaa
aggtcacctgtaggtgagttcttgctggatggcggaagaacaaagacctggctagttggg
aacaagctgataacgattacaacaagcgtgggcatggggacacgttctcttcttggcctg
gatacaggggagaaccatggtgaccctgagaacagctctcccgtgcaaaccgagcaagtc
aaggagtttccgtccatgctggatcttcagcagagaaagccgggtatgcaaacgcctcgt
cacagagtccgctccatgtctggagggactacactgagagctggatcattggaggggacc
cctctttcaaccagtatagggcagccaggggcaactccagtgaccagagcagagaaacct
tcccgtcgggcgcaggtgaagaaagaaaagaccaccctggctgactttgttcctgtactg
acacaaggctgggcagaggtattggttcgcagacccacaggtaacactagctggttgatg
agcctggaaaaccctctgagtcccttctcgtccgacattaacaacatgccgctgcaggag
ctttccaatgcactgatggcagccgagaggctcaaagagcaccgggagacggcactctac
aaatctctctctgtgccagcctccactttatctccctccacagccaagactactcttcta
cagcgcgcaaacacagaatcttgtgctgtgccagaagaaggggcgcaagccgatggggaa
gcggaggaagcgaccactcccggtggctctcaagagctggaagattttgaggctgtggtt
agtgaagacactgctagtgaggagaagactgctaagaagacggagtgcattagcagatct
tcatccacatccagtcaagaagagtctgctgccacccaaacagaagaatctgaggctggt
gggatacccatcgagggctccactcgtgaggtcccatttcagactttgagcaagtccagc
tcatctcctgaacttcaggccttgcaagagcttcctaaagagttggtctctacagaagac
atgaagaagccagctgccgacctcaaaacactaccccgcatagaaacccctttaagccat
agaactaaatctgaagaggaacgcagcactggggcattatccaaaccagaaggcggaatg
cgactggaaccagagttgcctgttttgtccccgcattctccaactggccaccgcccaagg
ggtcacactatctctgattctgagccatcccgcagaggcaggaggattcagatcgaccct
ttcaagaacagcaccaaatcaagcaaagctgagaaagtgcctggaatagacccgagcttt
gtgtttttgcagttgtaccattccccgttctttggtgacgagtccaataaacccatactg
gtccctaatacacagacattcgagcgaacaatgagccttctagatcgaatcccaccctac
gacacccacaaaattggtgttctctatgttggagaagggcagattggcagcgagcgtgct
atcctatccaatgagcatggctcgtaccgctacacacagttccttacagggctcgggaag
ctgattgagctgaaagacactcaacctgacaagatcttcctgggagggttggacggttgt
ggagatgacgggcagttcacttactgctggcacgatgatattatgcaagtcatttttcag
atcaccaccctgatgccaaacaaagagatcgatccgaaccgctgcaataagaaacgtcac
gtgggcaacaactttgtcaatatcatctacaatgactcgggcgagttctacaggttgggg
accctcaagggtcagttcaacttcgtagatgtcaacattcagcccttggaatgcgagagt
aacctggtgacgctgcaatgtcgaaaagatatggaaggccttgtagataccagtgtggca
aaaattgtgtcggacaaaaacttgcccttcttggcccgtcagatggctctacattcaaat
atggcttcccaagtccatcacagtaggtccaaccctacggatatttacccttcaaaatgg
attgccaggctccgacacataaagaagatgaggccgaagatacaagaggagttgcaggag
ctgagtgccagcatgccctaccaggtccctacgatctccaacaagcctccttcacagaac
cctcagactccccctggggcttttgaaacgggccagaggaccaggctcatttctgccgtg
gacgatttcaccgagtttgcttga

KEGG   Xenopus laevis (African clawed frog): 108703213
Entry
108703213         CDS       T01010                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04218  Cellular senescence
xla04910  Insulin signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    108703213
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108703213
  09143 Cell growth and death
   04115 p53 signaling pathway
    108703213
   04218 Cellular senescence
    108703213
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108703213
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108703213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108703213
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108703213
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 108703213
NCBI-ProteinID: XP_018094779
UniProt: A0A1L8EQW8
LinkDB
Position
9_10S
AA seq 1705 aa
MAKQTGRDPGLKEKVKMLLGLGPTRGKAKPSEWKHPECVITAELMKHAVEAICQAVCDLL
QPEQPAEGRFHVLHLLKAIILGQGEKLGVLRAYFFQIIKDYPSNEDVAERLEVFKALTDN
GREIAYLEEELAAFVLRWMDIGLTPDFLHVLVNLVKFNSCYLEHFIAPTVQMICLLCNRT
TSPYDIEVSLKVLDAVVCYNCLPSESIPIFVITLCRTINVKELCEPCWKLMRNLLGTHLG
HSAIYTMSRIMEDRVHMEDAPVLRGAVFFVGMGLWGAHRLFCLKNSPISVLPSFLKAMNC
NDAVVSYEIVLSVTRLIKKYGKDVQAATWDVLLDIIERLFQQLQVLRSQELKAAVHKLLT
TIEELYKLNEFHGDEERFFELLEKGADERPTASVVNLITYRAQSIHPGKEGWVMNLQKLM
DRYFRNESRSVVRMKVLDVLSVALSINRQFYEDELIEKVVTCQLAHIPEDKDHQVRKLAT
QLLVDLAECCHSCQFSSLMDIIEKVVNRSLSTPESGHDSSSLEDVKTSVLGLMVILQTKL
YILPASHAMRVYEMLINHIQLHYKYKYNSPIATSIRLQVFDFLLHLRADSLWRVGLPNKD
GAFRFSPYCLCESINEQEKRTAERKPAGTLSPPSGSPSLPSQTVALRMGFLPFSLAFGVI
LQCLKQETDWKVMKLVLNKLPQCLRYKLLNLSSPCDIDQLAASLCAMLTDKTASDRLYIT
PDSFSRTDLQLAVVPVLTALTSYHQHLELSKQRDMVRCLETGLIFRCAKQCVVALSMCMI
EMPSILIKSLPVLIVRLTHISATVTMAIPMLEFLSTLVRLPHLYANFAAEQYASVFAISL
PYTNPSKFNQYIVFLAHHVIAMWFIRCRLSLRRDFVPYITKGLRSNVLLSFDDTPEKDSF
RARSTSLNERPKSRVQNSVTSSSLSSADESSMAQADDSLKNLHLELTEICLDMMARYAFA
NFTAVPKRSPVGEFLLDGGRTKTWLVGNKLITITTSVGMRTRSLLGLDTGENQGDPENSS
PVQTEQVKEFPSMLDLQQRKPGMQTPRHRVRSMSGGTTLRAGSLEGTPLSISMGQPGAEK
PSRRTQVKNEKTTLADFVPVLTQGWAEVLVRRPTGNTSWLMSLENPLSPFSSDINNMPLQ
ELSNALMAAERLKEHRETALYKSLSVPASTLSPSTAKTTLLQRANTESCAVPEEGAQADG
EPEEGTTPGGFQELEDFEAVVGEDTTSEEKTAKKMECISRSSSTSSQEESAATQTEESDA
GGIPIEGSTREVPFQTLSKSSSSPELQALQELPKELSSTEDMKKPTADFKTLPHIETPSS
HRTKSDEERSTGLLVKSEGRMRLEPELPVLSPQSPTGHRPRGHTISDSEPSRRGRRIQVD
PFKNSTKAEKVPGIDPSFVFLQLYHSPFFGDESNKPILVPNTQTFERTMSLLDRIPPYDT
HKIGVLYVGEGQVGNERAILSNEHGSYRYTLFLTGLGKLIELKDTQPDKIFLGGMDGCGD
DGQFTYCWHDDIMQVIFQITTLMPNKEIDPNFCNKKRHVGNNFVNIIYNDSGEFYKLGTL
KGQFNFVDVNIQPLECESNLVTLQCRKDMEGLVDTSVAKIVSDKNLPFLARQMALHSNMA
SQVHHSRSNPTDIYPSKWIARLRHIKKMRPKIQEELQELSSSMPYQVTTISNKPPSQNPQ
TPPGAFETGQRTRLISAVDDFTEFA
NT seq 5118 nt   +upstreamnt  +downstreamnt
atggccaagcagacgggtagagatcctggactgaaggaaaaagttaaaatgttattggga
ctgggacctacacgagggaaagccaagccttcagagtggaagcatccggaatgtgtcatt
actgcagaattaatgaagcatgcagtagaagcaatatgccaagcagtttgcgacttgcta
cagcctgaacagcctgcagaaggtcgatttcacgttctgcacttattgaaggccattatt
ttggggcagggtgaaaaacttggtgtccttcgtgcctattttttccaaatcataaaagat
tatccttcaaatgaggacgttgcagagcggctagaagtttttaaagctctgacggacaat
gggagagaaattgcatatctagaggaagagcttgctgcctttgtcctccggtggatggat
attggtttgactccggatttcttgcatgttttggttaacctggttaagttcaatagctgt
tatttggaacactttattgctcctacggtgcagatgatatgcctcctctgtaatcgtact
acatctccttatgacattgaggtatccttgaaggttctggatgcagtggtctgctataac
tgccttccgtcggagagtatacccatatttgttataaccctgtgccgcacaataaatgtt
aaggagctgtgtgaaccatgctggaagctgatgcgtaacctgctgggcacccatctaggt
cacagcgccatttatactatgagccgtataatggaggatagagtccatatggaagatgcc
cctgtgctgagaggagctgtgttctttgtcggaatgggtctctggggagctcacaggctg
ttctgtctgaagaactcgccaatatctgttctcccttctttcctgaaggctatgaactgt
aacgatgctgtggtctcctacgagattgttttgtctgtgacgcggctaatcaaaaagtac
ggcaaggatgtgcaggctgccacgtgggatgtcctcctggatataatcgagcgcttattc
cagcagcttcaggtcctgcgaagtcaagaattaaaggctgcggtgcacaaactgctgacc
accatagaggaactttataaactgaacgaattccatggagatgaagagagatttttcgag
ctgcttgaaaaaggggcagatgaaagacccacggcatcagttgtgaaccttatcacctac
agagctcagtccattcaccctggtaaagaagggtgggttatgaacctacagaagctaatg
gacagatatttcaggaatgaatctcgcagtgttgtacgcatgaaggtcttagatgttctg
tctgttgcactgagcatcaatcgacagttttacgaggacgagttgatcgagaaggtagta
acgtgccagttagcccatatacctgaggataaggaccatcaggtgcgaaaactcgcaaca
cagctacttgtggacttggctgaatgctgtcactcctgccaattcagcagtctgatggat
atcattgagaaggtggttaaccgttctttgtctacaccagaatcaggtcatgattcttct
tctttagaagatgtgaaaacatctgttctggggctgatggttattctacagaccaagcta
tacattctgccagctagtcatgccatgcgtgtgtatgagatgctgatcaatcatatccag
cttcactacaaatacaagtacaactcgcccattgctaccagtatacgcctccaggttttt
gacttcctcctccacctccgagctgattccttgtggcgtgttgggctacctaacaaagat
ggtgccttcagattcagcccctattgtctctgtgaatccataaatgaacaagagaagaga
acagctgaacgtaagccagcaggcaccttatcaccaccctctggcagtccaagtctccca
tcacaaactgttgctctgcgcatgggatttctgccattctctctagcatttggggttatc
ctgcagtgcctaaaacaggaaactgactggaaagtcatgaaactagtgctgaacaaactg
ccacagtgtctgcgttacaaactcctcaacctttcatccccctgcgatatagatcaactt
gctgcctcactctgcgctatgcttacagataagactgcaagtgatcgcctttacattact
cccgatagcttctctcgtactgatctgcaactggcagtggttcctgtgctgactgcctta
acctcataccaccaacacctagagctctctaaacagagggatatggtgaggtgtctagaa
acaggcttgatctttcgctgtgccaagcagtgtgtagtggcactttccatgtgcatgatc
gagatgccaagcattcttataaaatctctgccagtcctcatcgtgaggctaacccatata
tccgccacagtcaccatggccattccgatgctggagtttctatcaaccttggtccgcctg
ccccacttgtatgcaaactttgctgcagagcagtatgccagtgtatttgccatctccctt
ccatacaccaacccatcaaaatttaaccaatacattgtatttctggcacaccatgtaatt
gctatgtggttcatccggtgcagactatccctgcggagagactttgtgccgtatataaca
aagggtttgcgatccaatgtcctgctgagcttcgatgacactccagaaaaggacagcttc
agagctcgcagtaccagcttaaacgaaagacccaaaagccgcgtgcagaactctgtcacc
agctccagcttgagttccgctgatgagagttctatggcccaggctgatgacagcctgaaa
aaccttcacctggaattgacggaaatctgcctggatatgatggcccgatacgcctttgcc
aacttcacggctgtgcccaaaaggtcgcctgttggtgagttcctgctggatggcggaaga
acaaagacctggctggttgggaacaagctgataacaattacaacaagcgtgggcatgagg
acacgttctcttcttggcttggatacaggggagaaccagggtgacccagaaaacagctct
cctgtgcaaacagagcaagtcaaggaatttccgtccatgctggatcttcagcagagaaaa
ccgggtatgcaaacgccccgtcacagagtccgctccatgtctggagggactacactgaga
gctggatcattggaggggacccctctttcaatcagtatggggcagccgggagcagagaaa
ccttcccgtaggacccaggtgaagaatgaaaagaccaccctggctgactttgttcctgta
ctgacacaaggctgggcagaagtgttggttcgcagacccacaggtaacacaagctggttg
atgagcctggaaaaccctctgagtcccttctcttccgacattaacaacatgccgctgcag
gagctttctaacgcattaatggcagccgaaaggctcaaagagcaccgggagacggcgctc
tacaaatctctctctgtgccagcctccactttatctccctccacagccaagactactctt
ctacagcgcgcaaacacagaatcttgcgctgtgccagaagaaggagcacaagctgacggg
gaaccagaggaagggactactcctgggggctttcaagagcttgaagattttgaggctgtg
gttggtgaagacactaccagtgaggagaagactgctaagaagatggagtgcattagcagg
tcttcatccacatccagtcaagaagagtctgctgctacccagacagaagaatctgatgct
ggtgggatacctattgagggctccactcgtgaggtcccgtttcagactttgagtaagtcc
agctcatctcccgaacttcaggccttgcaagagcttcctaaagagttgagctctacagaa
gatatgaagaagccaactgccgacttcaaaacactgccccacatagaaactccttcaagc
catagaactaaatctgatgaggaacgcagcactgggttattagtcaagtcagaaggcagg
atgagactggaaccagagttgcctgttttgtctccgcaatctccaactggccaccgccca
aggggtcacactatctctgattctgagccatcccgcagagggaggaggattcaggttgat
cctttcaagaacagcaccaaagctgagaaagtgcctggaatagacccaagctttgtattt
ttgcagttgtaccattcgccgttctttggtgatgagtcaaataagcccatactggtccct
aacacacaaacgtttgaaagaacaatgagccttctagatcgaatcccaccatatgacacc
cacaaaattggagttctttatgttggagaagggcaggttggcaatgagcgtgctatccta
tccaatgagcatggctcgtaccgctacaccctgttccttactgggcttgggaaactgatt
gagctgaaagacactcaacctgacaagatctttctgggagggatggacggttgtggagat
gacgggcagttcacctactgctggcacgatgatattatgcaagttatttttcagatcacc
accctgatgccaaacaaagagatcgatccaaacttctgcaataagaaacggcacgtgggc
aacaactttgtcaatatcatctataatgactcgggcgagttctacaagttgggtaccctg
aagggtcagttcaacttcgtagatgtcaacattcagcctttggaatgcgaaagtaacctg
gtgacgctgcagtgccgaaaagatatggaaggccttgtagataccagtgtggcaaaaatt
gtgtcggacaaaaacctgcccttcctggcccgtcagatggctttacattcaaatatggct
tcccaagtccatcacagtaggtccaaccctacggacatttacccttctaaatggattgcc
aggctccgacacataaagaagatgagaccaaagatacaagaggagttgcaggagctgagt
tccagcatgccctaccaggtcactactatctccaacaagcccccttcacagaacccacag
actccccctggtgcttttgaaactggccagaggacacggctcatttctgctgtggacgat
ttcactgaatttgcttaa

DBGET integrated database retrieval system