KEGG   Xenopus laevis (African clawed frog): 108702018
Entry
108702018         CDS       T01010                                 

Definition
(RefSeq) protein reprimo-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108702018
SSDB
Motif
Pfam: Tmemb_9 DUF1072
Other DBs
NCBI-GeneID: 108702018
NCBI-ProteinID: XP_018092508
UniProt: A0A1L8EVY0
LinkDB
Position
9_10L
AA seq 103 aa
MNQTEAGLLFSNSSDSIGSILGCCTQASIVTYDGSEVPSLEARNLFIMRVVQIAVMCVLS
LTVVFGIFFLGCNLLIKSEGMINFLVKERRPSKEIEAVVVGPY
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaccagacagaagccggattactgttttccaacagcagtgactctattggaagtatc
ttggggtgctgcacccaggcttcaatagtaacatatgatggatctgaggtgccttctctt
gaggcgaggaacctattcatcatgcgagtggttcagattgcggtgatgtgtgttctatcc
ctcacggtcgtgtttgggatcttctttttgggatgcaacttgctaataaaatccgaaggg
atgataaactttttggtcaaggaaaggagaccttctaaagaaattgaagcagtcgtcgtc
ggtccttattaa

KEGG   Xenopus laevis (African clawed frog): 108702402
Entry
108702402         CDS       T01010                                 

Definition
(RefSeq) protein reprimo-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108702402
SSDB
Motif
Pfam: Tmemb_9 DUF1072
Other DBs
NCBI-GeneID: 108702402
NCBI-ProteinID: XP_018093349
UniProt: A0A1L8EP37
LinkDB
Position
9_10S
AA seq 103 aa
MNQTEAGLLFSNGTDSIGSILGCCTPASVVTDDGFEVPPLDERNLFIMRVVQIAVMCVLS
LTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEIEAVIIGPY
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaccagacagaagccggattactgttctccaacggaactgactctattggaagtatc
ttggggtgttgcaccccagcttcggttgtaacagacgatggatttgaggtgccccctctt
gacgagaggaacctgtttatcatgcgagtggtacaaattgcagtgatgtgtgttctatcc
ctcacagtcgtgtttgggatcttctttttgggatgcaacctgctaataaaatcagaaggg
atgattaactttttggtcaaagacagaagaccttccaaagaaattgaagcagtcatcatt
ggcccttattaa

DBGET integrated database retrieval system