KEGG   Xenopus laevis (African clawed frog): 108702168
Entry
108702168         CDS       T01010                                 

Definition
(RefSeq) signal transducer and activator of transcription 3.1-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04217  Necroptosis
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108702168
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108702168
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108702168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108702168
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108702168
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int PBECR5 PRKG1_interact AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 108702168
NCBI-ProteinID: XP_018093166
LinkDB
Position
9_10S
AA seq 656 aa
MAQWNQFQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAFAASKESHATLVFHNL
LGEIEQQYRRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEEGRLLQTAA
AAAQMGRPEHPTAAVVTEKQQMLEQHLQDVRKKVQDLEQKMKLVENLQDDFDFKYKTLKS
QSDLSEMNGNQQLVTRQKMQQLEQMLAALDQLRRTIISDLASLLSAMEYVQKTLTDEELA
DWKRWQQIACIGGPPNICLDRLENWITSLAESQLQIRQQIRKLEELQQKVSYKGDPIVQH
RPMLEERIVELFRNLMKSAFVVERQPCMPMHPDWPLVIKTGVQFTTKVRLLVKFPELNYQ
LKIKVCIDKDSGDVAALRGSRKFNILGTSTKVMNMEESNNGSLSAEFKHLTLREQRCGNG
GRANCDASLMVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYN
MLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNHSG
CQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGCSFHVLGTAPYLKTKFIC
VTPTTCSSTLDLPMSPRTLDSLMQFPGEGAESSAGNQFETLTFDMELTSECASSPM
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccaatttcagcagctggacaccagatacttggagcagttacaccag
ctctacagtgacagctttccaatggagcttcgccagttccttgccccgtggatagagagc
caagactgggcatttgcggccagtaaggagtctcatgccacgttggtgtttcacaatctc
ctgggggagatagagcagcaatacagacgatttctgcaggaatccaatgtactttatcaa
cacaacctgcgacggattaaacagttcttgcagagccgatatttggagaaacccatggag
attgctcggattgtggccaggtgtctgtgggaagaagggcgacttctccaaacggctgct
gctgccgcacagatgggccgacctgaacaccccaccgcagccgtggtcactgaaaagcaa
cagatgttggagcaacatttacaggacgtgcgcaaaaaggttcaggaccttgagcagaag
atgaaacttgttgagaaccttcaggatgactttgatttcaagtacaaaactttaaaaagt
caaagtgacctttctgagatgaatggcaaccaacagttggtcacaaggcagaagatgcaa
cagctggagcagatgctggcggcattggatcagttgagaagaactattattagtgatctg
gccagtctcctgtcagccatggagtatgtgcagaagacactgactgatgaagaacttgct
gactggaagagatggcagcaaattgcctgcattggtggacccccaaatatttgccttgat
cgacttgaaaactggataacttccctggctgagtcccagctgcagatccgtcaacagatc
agaaaactagaggagctacagcagaaagtttcctataagggagaccccattgttcaacac
cgacccatgctggaggagagaattgtggaattatttagaaatctcatgaaaagtgccttt
gtagtggagaggcagccgtgcatgcccatgcatcctgactggccactggttattaagacc
ggagtacaattcactaccaaagttaggctgctggtgaagttcccagagctcaattaccaa
ctgaaaatcaaagtttgcattgataaggactccggtgatgtagctgcactaagaggttcc
cgcaagttcaatatccttggtacaagcaccaaagttatgaacatggaggaatcaaataat
gggagcctgtctgctgagttcaaacacttgactctgagggagcagcgatgtggcaatggg
ggaagagcaaactgtgatgcctcccttatggtgacagaagaacttcatctaatcacattt
gagacagaagtttatcatcaggggctgaagatagacctggagactcattccctgcctgtt
gtggtgatttccaacatctgtcagatgcccaatgcttgggcctctatcctgtggtacaac
atgctgaccaacaacccaaagaatgtcaacttttttaccaagccccccattggcacttgg
gatcaggtggcagaggtgctaagctggcagttctcctccaccacaaaacgtggcctaagt
attgagcagctaaccacactggcagagaaactgttgggcccaggagtcaaccattctgga
tgccaaatcacctgggccaagttctgtaaagaaaacatggcaggcaaagggttttccttc
tgggtttggctggacaatatcattgaccttgtgaagaaatatattctggcactttggaat
gaaggatgctcattccatgtacttggcactgctccgtatctaaagaccaagtttatctgt
gttaccccgacaacatgtagtagcacattagatttgccaatgtctcctcggactttagat
tctctgatgcagtttccaggggaaggggcagaatccagtgctggaaaccagtttgagacc
ctcacgtttgatatggagttaacatctgaatgtgcatcttctcccatgtga

DBGET integrated database retrieval system