KEGG   Xenopus laevis (African clawed frog): 108702551Help
Entry
108702551         CDS       T01010                                 

Gene name
map3k14.S
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 S homeolog
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04210  Apoptosis
xla04625  C-type lectin receptor signaling pathway
xla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108702551 (map3k14.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108702551 (map3k14.S)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108702551 (map3k14.S)
   04672 Intestinal immune network for IgA production
    108702551 (map3k14.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108702551 (map3k14.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108702551 (map3k14.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  Other
   108702551 (map3k14.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Eapp_C Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 108702551
NCBI-ProteinID: XP_018093574
Xenbase: XB-GENE-17338713
UniProt: A0A1L8EL46
LinkDB All DBs
Position
9_10S
AA seq 892 aa AA seqDB search
MAVGRQQSSHLDPEIPQKYCKCEGTVAKESAELGMAKNLKNLLPWSDVIEKGTAKEEKQS
PSLYISIIAQPECENNHEICPSFQQHQIYNTDSKQYSHLNIEHTANNVVNSTEGKPSHQS
KPPRIKGKKAKRKRKQKNGSQNPEQRGQRIPEQECRAPIPVQDEESQQSLESLNVWWTDA
KQKTSGLKEKHPTISNEHPLQDLCLLKDDRLKEHHKLINLKQCIYHIGGGKLPPSAALHV
PPLDSLSISEFLKTLGTKSSCDLDYGETTSPEYGSPKLIRPYEDPKTDSVEECMFEALRG
SVSMGEPKSLSTFAKAWNQEADDENREMDTEGVILTEKLKTEDYEYKEGIHWTKDGEALG
SGSFGDVLPAKDEQTGVRFAVKKIHQSRFRSQELTSCLWVSSPKLVPVYGAVREGPCINV
FLKLMTGGSLGQLIKLNGFLPEDRALYYLGQVLEGLTHLHAKSIVHGDIKADNILLSEDG
NEAYLSDLGHSAYLPMDGSKKQLLTADYVPGTETHMAPEIVRGDDCDTKLDVWSSCCMML
HMLNGWHPWSRTHAPPLCLKIATEPPPVQEIPPTCDPQTCEVIVEGLEKDPVRRVTAARL
QEKVHLALHKIGGLKSPCKSEYKTPRSFPDTTLPPSPVRATESPISKHEPALIDTRPSPS
PNKSKPEFIKEKTISSLTDSSAVRPNILPRKEIQQMEREYLLTNLFLASSLEEQEQMLSC
LSEDNLDLHRSHKDSLHTFDTASSGIYSWDSEMDPLSLKSDSLNHEGVTTTPSWFNGYKV
QLQTLSGEKLHIWESGRTKLGDLALGISSQIPLQSFTILTPEGKPVPWSTDIADCGIYLQ
CALAPDRGGDWIWRVMRGRLEQGPTGEVYTGGGSGGSPCKKEEVFPNTEHPV
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggacgtcagcagtcctctcacctggaccctgaaataccccaaaagtactgc
aaatgtgaagggacagtggcaaaagagtcggcagaacttggaatggcaaaaaatcttaaa
aatcttcttccatggagtgacgtcatagagaaaggaactgccaaggaggaaaaacaaagt
ccatctctatacatctcaatcattgcacaacctgagtgtgagaataatcatgagatctgc
ccaagtttccagcaacatcaaatttacaacactgactccaaacagtacagtcacttgaac
attgagcacactgccaataatgtggtgaactcaaccgaggggaagccatcccatcagtca
aagcctccacgaatcaaagggaagaaagcaaagcgaaagagaaaacagaaaaatggttct
cagaatccagaacaaagagggcaaaggattcctgagcaggagtgtcgggcccctatccct
gttcaggatgaagagtcccagcagagcctggaaagtctaaacgtttggtggacagatgcg
aagcagaagacgtctggtttaaaagaaaaacatcccacaatatctaatgaacatccactg
caagacctctgtctacttaaagatgatcgactgaaagaacaccataagcttattaacctt
aaacaatgcatataccacataggaggtgggaaactaccaccatcagctgctctccatgtc
ccacctctagacagcttaagtatttctgaatttcttaaaaccttggggacaaagagttct
tgcgatttagactatggagagaccacaagcccagagtatggctcccccaagctcataaga
ccttatgaagacccaaagactgattctgtggaagaatgtatgtttgaagctctgagaggc
agtgtgagcatgggggagcctaaaagcctgtccaccttcgccaaggcctggaaccaagaa
gcagatgatgagaatagagaaatggatactgaaggggtcatactaacagagaagctgaag
acagaggattatgaatacaaggaaggcattcactggaccaaagacggagaagctcttggg
tctggatcctttggagatgtgcttcctgcaaaggatgagcaaactggagtcagatttgca
gttaaaaagatacatcagagtagattccggtcccaagaactgacttcgtgcctttgggtc
tcatccccaaaacttgtcccagtgtatggagcagtccgggagggaccttgtatcaatgta
tttcttaagcttatgacaggaggttccttgggacaactcatcaagttaaatgggttttta
ccagaagatcgggccctttactaccttgggcaggtactggagggccttacacaccttcat
gccaaaagcattgtgcatggagatattaaagctgacaatattctcctgtcggaagatggc
aatgaagcatacctgtctgatctggggcattctgcttatctgcccatggatggttccaag
aagcagcttctgacagcggactatgttcctgggacagagacacacatggcccccgaaata
gtacggggggacgactgtgacacaaagctggacgtgtggagctcctgctgtatgatgctt
catatgctgaatggctggcacccatggagccgaactcacgcacctccgctgtgcctgaaa
atcgccactgagccacctcctgtgcaggagataccccccacctgtgaccctcaaacctgt
gaggttattgtagagggtctggaaaaagatccagtcaggagagtgacggcagcgcggcta
caggagaaagtgcatttggctttgcataaaattgggggtttgaaatctccatgtaaatct
gaatacaaaacgccaaggagcttcccagataccacattaccccccagccctgtaagagca
actgaaagccctatctccaagcatgaacctgccttgatcgataccaggcccagccccagt
cccaacaaatcgaaaccagagttcattaaggagaagacaatcagcagcctgactgacagc
agcgcagtgcggccaaatatcttgcctaggaaggaaatccagcagatggaaagagaatat
cttctcaccaatctgttcctggcaagttccctggaagaacaggagcaaatgttgtcctgc
ctaagtgaggacaacctggatctgcatcgcagtcacaaggactcactacatacttttgac
acagcaagctctggaatttattcttgggacagcgagatggatccactgagtctcaaaagt
gactcccttaaccatgaaggggtcacaaccactcccagctggttcaacgggtacaaggtt
cagctgcaaacgctgagtggggagaagctgcacatctgggaatctggaaggactaaactt
ggagatctggccttgggcattagcagtcagatcccgctgcagtcgttcacaatattgacc
ccagaaggaaagccagttccatggagcacagatatcgctgactgtggaatatatttgcag
tgtgcattagccccggatcgtggtggggattggatctggcgagtgatgagaggaagactg
gagcagggacccacaggagaggtgtatacaggtggaggcagtggtggaagtccctgcaag
aaagaagaggtctttccaaacacagaacatccagtctaa

DBGET integrated database retrieval system