KEGG   Xenopus laevis (African clawed frog): 108702771
Entry
108702771         CDS       T01010                                 

Gene name
rbl1.S, p107, prb1
Definition
(RefSeq) retinoblastoma-like 1 S homeolog
  KO
K04681  retinoblastoma-like protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108702771 (rbl1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108702771 (rbl1.S)
   04218 Cellular senescence
    108702771 (rbl1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108702771 (rbl1.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    108702771 (rbl1.S)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 Rb_C
Other DBs
NCBI-GeneID: 108702771
NCBI-ProteinID: XP_018093927
Xenbase: XB-GENE-17332001
LinkDB
Position
9_10S
AA seq 1082 aa
MSLKTTSPKMQRGDYSLPGIMCTPAGALDDRIALPAPRINYEGSPCTQGPGLDPLNAGRD
RIEKPTWKWRKDTQGEVKHWLACALYAACRKGVIPTVGKGIMEGNGVSLTRILRSAKLSL
IQFFNKMKKWIDMSNLPQEFRQRVEHLERNFEVATVIFKKFEPIFREIFQNPHEEPPRLP
RSRKQRRLQCCVKDLFSFCWTLFVYSKGTGGSEGQCNVVVKDQAEGNFCLIGDDLVNSYH
LLLCCLDLIYAHVLQCPNKEDLLNPSFTAKLPPIDSSSEDTPCIIGALCELYDGISVEAK
GIKEHYFKPYIAKLYDKKILKGSCLLDVSCFTDNNKSLNKEYEEYVLTKGDFDERVFQGV
DAEEEIGSPRKFVVEFPTGNCTPRKQMECNLQQHFEKKSSFAPSTPLTGRGYLKEEPTVI
TPVSSATQCVSRLQSMVTGLRNAPSEQLIDVFKSCVRNPLENVLNIVRDIGRLFCLHYTT
STEDQPGSHIDFAINRWKLAEILYFKVLETIVVQESRRLYGKDLTALLEQGIFHQSLIAC
CLEIVLFAYTSPKTFPWTIEVIKLSSFYFYKVIEVFIRSEDGLSRDMVKHLNTIEEQILE
SRAWTSDSVLWVHLDAVDDVPSCEEVIIPSNFESENEAGLGHLPMMPASPIVHRRLKEVR
TGLCGSYRQDCQPLSPISVHDRYSSPAAGSAKRRLFGDDCPREPAADKITTPDITSIRIA
ISQSSDRTAQPIGQTIAIPVQGVANETGKSLCVTMKTYPSQSENSFPVPLTAQALISPLT
KRPLGRSQESCPTSACKPKKTGSLALFFRKVYHLASVRLRDLCLKLDVSNDLRRKIWTLF
VYSVVHCTDLMKDRHLDQLLLCAVYIMAKISKEERLFHDIMKCYRNQPQANSHVYRSVLL
KRLPQAIGDETSQDVEMTASNSNDSHPTPSGFTGSPCGQAERGDLITFYNNVYVGRVRLF
ALKFAGCTQDHLVDAPPLSPFPSIKQQAISPRRVSQQHSIYVSPHKNSGNLTPHAALLYK
FSGSPSKSLQDINSMLKQEQRGRKRIIAIDSDTESPAKRLCQENDDALLKRLQDVVSERA
NH
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgtcattgaaaactacaagccccaaaatgcaacgcggagactattcgcttcccgggata
atgtgtacacccgccggggctctcgatgaccgaatcgctttacccgccccacgaattaat
tatgagggttctccgtgtacacagggtcccggtttggaccctctcaatgcgggaagagac
aggattgaaaagccgacatggaaatggcggaaggatacacagggagaagtgaagcattgg
ttagcatgtgccttgtatgcagcatgtcgaaaaggcgtcattccaactgttgggaaagga
atcatggagggtaatggcgtgtcgctgacgcggatactgcgctctgcaaaactaagcttg
attcagttcttcaataaaatgaagaagtggatagatatgtctaaccttccgcaggagttc
cgacagcgagtggagcacttggaaaggaactttgaagtggccaccgttatatttaagaaa
tttgaaccgatctttcgggagatatttcaaaacccccacgaggagccaccaagattacca
aggagcagaaagcaaaggaggctgcagtgctgtgttaaagatctcttcagtttctgctgg
accttatttgtttactccaagggtacagggggatctgaaggccaatgtaatgtggtggta
aaagaccaggcagagggtaatttctgcttgattggagatgatttggttaattcttatcac
ttgcttttatgctgcttggaccttatttatgcgcacgtgctacagtgccctaataaagaa
gatctgctaaatccttcctttacagcaaagcttcctcctattgactccagctcagaggat
accccatgcatcattggtgcactgtgtgagctatacgatggaatatctgtggaagccaag
gggataaaagaacattattttaagccatatatagcaaaactttatgataaaaagatttta
aaaggatcctgtctattggatgtctcttgtttcacagataacaataaatccttgaataaa
gagtatgaagagtatgtccttacgaagggagactttgatgagcgggtttttcagggtgtc
gatgcagaagaggagattggaagtcccagaaaatttgttgtggaatttcccacgggaaac
tgcactccacggaagcaaatggagtgcaacctgcagcaacattttgaaaagaaaagttct
tttgctccatctactcctctgactggtaggggttacctgaaggaggagccaactgtaatc
acacctgtttcatccgcaacacagtgtgtcagcaggttacagagcatggtgacaggactc
agaaatgctccaagtgagcagctgattgacgttttcaagtcatgtgttcgaaacccatta
gagaatgtattgaatattgtccgagatattggacgtctattttgccttcactatacaacg
tccacagaagaccagcctgggtctcatattgattttgcaatcaatcggtggaaactggct
gaaattttgtactttaaagtactagagaccatcgttgtacaggaaagcaggagactttat
gggaaagatttgacggctctgctagagcaaggcatctttcaccagtcactgattgcctgc
tgtctggaaattgtcctatttgcttacacttctcccaagaccttcccgtggaccattgaa
gtaattaaactgagttctttctacttctacaaggtaatagaagtgtttattcgctctgaa
gatgggctatcacgcgatatggtaaaacacctcaataccattgaagaacaaattttggag
agccgtgcctggaccagtgattctgttctctgggttcatcttgacgctgttgatgatgtg
ccaagctgtgaagaggtcatcatacccagcaactttgaatctgagaatgaggctgggctt
ggccacttgcccatgatgcctgcatctcccattgttcatcgtcgtttgaaagaagttcga
actggcctatgtggatcatataggcaagactgccagccactctccccgatttctgttcat
gaccgatacagttcaccagctgctggtagtgccaagaggaggctctttggtgatgactgt
ccaagggagccagctgctgacaaaataaccacacctgatatcaccagcataaggattgca
ataagccagtcttctgatagaactgcccagcctattggacaaaccattgctatacctgtt
caaggtgtggcgaatgaaactggcaaaagcctttgcgttacaatgaaaacgtatccatca
caaagtgaaaattcttttccagtgcctttaactgcacaagccctgatcagtccacttaca
aagcgtccgttgggcagatctcaggaaagctgtcccacttcagcatgcaagcccaagaaa
acgggctctctggctttgttcttcagaaaggtctatcacttggccagcgtccgtctccgt
gacttgtgcctaaagctggatgtgtccaatgatttgcggcgaaagatctggaccttgttt
gtgtattcggttgtccattgcacagacctgatgaaagacagacacttggatcagctcctc
ctctgtgctgtgtacattatggccaaaatcagtaaagaagagaggttgtttcacgacatc
atgaaatgttatcgcaaccagccccaggcaaacagccacgtttatagaagtgtattattg
aagaggttacctcaagcaattggagatgaaacaagtcaggatgtagagatgacggcaagc
aattccaatgactctcatccaacccccagcggttttactggcagcccctgtggccaagca
gagcgaggagatctcattacgttttacaacaatgtctatgtaggacgcgtgagattattt
gcactaaagtttgccggctgcactcaagaccatctggtggatgctcctcctctttcccca
tttcccagcatcaagcaacaagctatttctccccgccgagtatcccagcaacattctatt
tatgtctctccccataagaacagcggcaacctgactccccacgcagccctcctgtacaag
tttagtggaagtccttcaaaaagcttgcaggacataaacagcatgctgaaacaggagcag
aggggtcggaagcgaatcattgctatagacagcgacacagagtctccagcaaagcggctt
tgccaggaaaatgacgacgctctgctgaaacgcctgcaggatgttgtgagcgagagggcc
aaccattag

KEGG   Xenopus laevis (African clawed frog): 431930
Entry
431930            CDS       T01010                                 

Gene name
rbl1.L, p107, prb1, rbl1
Definition
(RefSeq) retinoblastoma-like 1 L homeolog
  KO
K04681  retinoblastoma-like protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    431930 (rbl1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    431930 (rbl1.L)
   04218 Cellular senescence
    431930 (rbl1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    431930 (rbl1.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    431930 (rbl1.L)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 Rb_C
Other DBs
NCBI-GeneID: 431930
NCBI-ProteinID: NP_001084880
Xenbase: XB-GENE-976497
UniProt: Q6NRA7
LinkDB
Position
9_10L
AA seq 998 aa
MEHLQSGGRSQALASMCLVCSMSKKRHTNSWKRNHGGNGVSLTRILRSAKLSLIQFFNKM
KKWIDMSNLPQEFRERVERLERNFEVATVIFKKFEPIFREIFQNPHDEQPRLPRSRKQSI
LFCRRLQCSVKDLFSFCWTLFVYSKGNFCLIGDDLVNSYHLLLCCLDLIYAHVLQCPNKE
DLLNPSFTAKLALDSSSEDTPCIIGALCELYDGISVEAKGIKEHYFKPYIAKLHDKKILK
GACLLDVSCFTDNNKSLNKEYEEYVLTKGDFDERVFLGVDADEEIGSPRKFVEFPIGNCT
PRKQMECNLQQHFEKKRSFAPSTPLTGRGYLKEEQTVITPVSSATQCVSRLQSMVAGLRN
APSEQLIEVFKSCVRNPIENVLNIVRDIGLRFVDHYTQSTEDQPGSHIDFAVNRWKLAEI
LYFKVLETIVVQESRRLHGKDLTALLEQDIFHQSLIACCLEIVLFAYSSPKTFPWTIEVL
KLSAFYFYKVIEVFIRSEDGLSRDMVKHLNTIEEQILESRAWTSDSVLWVHLDAVDDVPT
CEEVIIPSNFETGNEALVGHLPMIPASPIVHPRVKDLGGSYRRDCQPLSPISVHDRYSSP
AAGSAKRRLFGDDCPREPAADKITTPDITRIRIAISPSPVKTVYPIGHAVAIPVQGVALE
TGKSLSVTMKTSPSQSENSVPVPLTAQALISPLTKHQLGRNLETCPTSARKPKKTGSLAL
FFRKMYHLASVRLRDLCLKLDVSNDLRRKIWTLFVYSLVHCTDLMKDRHLDQLLLCAVYI
MAKISKEERLFHDIMKCYRNQPQANSHVYRSVLLKRLPQASEDETSTSQDVEMTASNSND
SHPTPSGFTGSPCGQAERGDLITFYNNVYVERVRLFALKFSSSTQDHLVDAPPLSPFPSI
KQQAISPRRVSQQHSIYVSPHKNSGNLTPHTALLYKFNGSPSKSLQDINSMLKQEQRSRK
RIIAIDSDTESPAKRLCQENDDALLKRLQDVVSERANH
NT seq 2997 nt   +upstreamnt  +downstreamnt
atggagcacctacagtctggagggagaagtcaagcattggctagcatgtgccttgtatgc
agcatgtcgaaaaagcgtcataccaacagttggaaaaggaatcatggagggaatggcgtg
tcgctgacacggatactgcgctctgcaaaactaagcttgattcagttcttcaataaaatg
aagaagtggatagatatgtccaaccttccgcaggagttccgagagcgagtggagcgtttg
gaaaggaactttgaagtggccacggttatatttaagaaatttgaaccaatctttagggag
atatttcaaaatcctcacgacgagcaaccaagattaccaaggagcagaaagcaaagtatt
ttgttctgcaggaggctgcagtgtagtgttaaagatctcttcagtttctgctggacatta
tttgtttactccaagggtaatttctgcttgattggagatgatttggttaattcttatcac
ttacttttgtgctgcttggatcttatttatgcacacgtgctacagtgccctaataaagaa
gatctgctaaatccttcctttacagcaaagcttgcccttgattccagctcagaggatacc
ccgtgcatcattggagcactgtgtgagctatacgatggaatatctgttgaagccaagggg
ataaaagaacattacttcaaaccatacatagcgaaacttcatgataaaaagattttgaaa
ggagcctgtcttttggatgtctcttgtttcacagataacaataaatccttgaataaagag
tatgaagagtatgtccttactaagggagactttgacgagcgggtgtttctgggtgtagat
gcagacgaggagattggaagtcccagaaaatttgttgaatttcctataggaaactgcact
ccacggaaacaaatggagtgcaacctgcagcaacattttgaaaagaaaaggtcttttgct
ccatctactcctctgactggtaggggttacctgaaggaggagcaaactgtaatcacacct
gtttcgtcagcaacacaatgtgttagtaggttacagagcatggtggcaggactcagaaat
gctccaagtgagcagcttatcgaagttttcaagtcatgtgttagaaacccaatagagaat
gtattgaatatagtccgagatatcggacttcgattcgtcgatcactatacacaatccaca
gaagaccaacctgggtctcatattgattttgcagtcaatcggtggaaactggctgaaatt
ttgtactttaaagtactagagaccatagttgtccaggaaagcaggagacttcatgggaaa
gatttgacggctctattagagcaagacatctttcatcagtcactgattgcctgctgtttg
gaaattgtcctatttgcttacagttctcccaagaccttcccctggaccattgaagtactt
aaactgagtgctttctacttctacaaggtaatagaagtgtttattcgctctgaagatggg
ctgtcacgggatatggtaaaacacctcaataccattgaagaacaaatcttggagagccgt
gcctggaccagtgattctgttctctgggttcatcttgatgctgttgatgatgtgccaacc
tgtgaagaggtaataatacccagcaactttgaaactggaaatgaggctttggtgggccac
ttgcccatgatacctgcatctcccattgttcatcctcgtgtgaaagacctggggggatca
tataggcgagactgccagccactctcgccgatttctgttcatgaccgttacagttcacca
gctgctggtagtgccaagaggaggctctttggagatgactgcccaagggaaccagctgct
gataaaataaccacacctgatatcacccgcataaggattgcaataagcccatctcctgtt
aaaactgtctatcctatcggacatgcagttgccatacctgtacaaggcgtggcacttgaa
actggcaagagcctttctgttacgatgaaaacgtctccatcgcaaagtgaaaattctgtt
ccagtgcctttaactgcacaagccctgatcagcccgcttacgaagcatcagttgggtaga
aatctggaaacctgtcccacatcagcacgcaagcccaagaaaacgggctctctggctttg
ttcttcagaaagatgtatcacttagctagtgtccgtctccgtgacttgtgcctaaagctg
gatgtgtccaatgatttgcggcggaagatctggactctgtttgtgtactcgcttgtccat
tgcacagatctaatgaaagacagacacttggatcagctcctcctctgtgctgtgtacata
atggccaagatcagtaaagaagagagactgtttcacgacatcatgaaatgttacagaaac
cagccccaggcaaatagccacgtttatagaagtgtgttattgaagaggttacctcaagca
agtgaagatgaaaccagcacaagtcaggatgtagagatgactgcaagcaattccaatgac
tctcatccaacccccagtggttttactggcagcccctgtggccaggcagagcgaggagat
ctcattacgttttacaacaatgtctatgtagaacgtgtgagattatttgcactaaagttt
tccagcagcactcaagaccatctggtggatgcacctcctctttccccatttcccagcatc
aagcaacaagctatttctccccgcagagtatcccagcaacattctatttatgtgtctccc
cataagaacagtggcaacctgactccccacacagccctcctgtacaagtttaatggaagc
ccttcaaaaagcttgcaggacataaacagcatgctcaaacaggaacagaggagtcggaaa
cgaatcattgctatagacagcgacacagagtctccagcaaagaggctttgccaggaaaat
gacgatgctctgctgaaacgcctgcaggatgttgtgagcgagagggccaaccattag

DBGET integrated database retrieval system