KEGG   Xenopus laevis (African clawed frog): 108702988Help
Entry
108702988         CDS       T01010                                 

Gene name
gad1.1.S, cpsq1, gad67
Definition
(RefSeq) glutamate decarboxylase 1 S homeolog
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00250  Alanine, aspartate and glutamate metabolism
xla00410  beta-Alanine metabolism
xla00430  Taurine and hypotaurine metabolism
xla00650  Butanoate metabolism
xla01100  Metabolic pathways
Module
xla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    108702988 (gad1.1.S)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108702988 (gad1.1.S)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108702988 (gad1.1.S)
   00430 Taurine and hypotaurine metabolism
    108702988 (gad1.1.S)
Enzymes [BR:xla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108702988 (gad1.1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108702988
NCBI-ProteinID: XP_018094340
Xenbase: XB-GENE-17341787
LinkDB All DBs
Position
9_10S
AA seq 589 aa AA seqDB search
MASSSPSSSDTNQDTNPINLRPTTYDTWCGVAHGCTKKLGLKISGFLQRNNSLDDKGRIV
SSFKERHASKNLLVCENIEDSRFRHAETDFSNLFARDLLPAKNGEEFTMQFLLEVVDILL
NYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDNPESLEQILVDCRDTLKYGVRTGHP
RFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWTEKDGD
GIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAAPRLVLFTSENSHYSIKKTGAALGFGS
ENVILVKSDERGKLIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPISEIADICEK
YNLWLHVDAAWGGGLLMSRRHQHKLNGIERANSVTWNPHKMMGVLLQCSAILLREKGILQ
GCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEAQINKCLE
LADYLYSKIYNRDGFEMVLKGEPEHTNVCFWYIPPSLRGMPNSEERQEKLHRVAPKIKAL
MMESGTTMVGYQPHGDKVNFFRMVISNPAATKSDIDFLVEEIERLGQEL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcttcaccttcatcatcggataccaaccaggacaccaatccaatcaatcta
cgacccacaacctacgacacatggtgtggggtggcacatggatgcacgaaaaagcttgga
ctaaagatctctggcttcctgcagaggaataacagtttggatgacaaaggcaggattgtg
agttccttcaaagagaggcatgcttccaaaaatctcttggtgtgtgaaaatattgaggat
tcccggtttcgccatgctgagacagacttctccaatctctttgctagagatttactgccc
gctaagaatggggaagagttcactatgcagttcctactggaggtggttgacattctccta
aactacgtaaggaaaacatttgatagatccaccaaagtcctcgactttcaccatcctcac
caacttctagagggcattgaaggcttcaatctggagctgtctgacaacccagagtccttg
gagcaaatcttggtggattgtagggataccctcaagtatggagtgagaacaggacatcct
cgttttttcaatcaactctcaacaggattggacattattggcttggctggggaatggctg
acatcaactgccaacactaacatgtttacatatgagatcgcaccagttttcgtcctcatg
gagcagattacacttcggaaaatgagagaaataattggctggacagaaaaagacggagat
ggaatattttctccaggtggtgctatctccaacatgtacagcattatggctgcccgctac
aaatactttcccgaagtgaagaccaaaggcatggcggcagcccccagattggtcctcttt
acctctgaaaatagccactattccataaagaaaactggtgctgcattagggtttggaagt
gaaaatgtaatcctggtaaagagcgatgaaagggggaagctaattcctgctgatttggaa
gcaaaaatccttgaagcaaagcaaaagggttatgttcctctatatgttaatgctacagct
ggaacaactgtctatggtgcgtttgatccaatatctgagatagctgatatctgtgaaaaa
tacaacctctggcttcatgttgatgctgcgtggggaggtggactgcttatgtccagaagg
caccagcataaattaaatggaatagagagggctaattctgtcacttggaatcctcataag
atgatgggtgtcttactccaatgttctgcaattctcttaagagaaaagggcatactacaa
ggttgcaatcagatgtgcgcagggtacctgttccaacaagacaaacaatatgatatatca
tatgacacaggagataaagcaatacagtgtggtcgacatgtagacatattcaagttctgg
ctgatgtggaaagccaagggcactgttggatttgaagctcagatcaataagtgcttggag
cttgcagactatctctactctaagatctataaccgggacggctttgaaatggtccttaag
ggagagcctgaacatacaaatgtctgtttctggtacatccctccaagtctaaggggaatg
cccaatagtgaagaaagacaggagaagctgcacagggttgctcctaaaatcaaggcttta
atgatggaatctggcacaacaatggtgggataccagccacatggagataaagtcaatttc
ttccgaatggtcatctcaaacccagcagctaccaagtcagacatcgactttcttgtagaa
gaaatcgaaagattgggtcaagaattgtaa

DBGET integrated database retrieval system