KEGG   Xenopus laevis (African clawed frog): 108703274Help
Entry
108703274         CDS       T01010                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
xla04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108703274
   00500 Starch and sucrose metabolism
    108703274
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108703274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    108703274
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108703274
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108703274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 108703274
NCBI-ProteinID: XP_018094878
LinkDB All DBs
Position
9_10S
AA seq 897 aa AA seqDB search
MSMPGSLGRSGSSEGSVWSLLMLLLLSAVCSGAPSQETQPSPLQCNLSPNSRFDCAPEKI
VSKEECEARGCCYSPAEHNGNIGQPWCFYPPSYPSYKMDNLTQTDRGYSATLKRSMGTFM
PRDIMTLQLEVFFETESRLHFTIKDPAEKRYEVPIPTPQVHGKAPNTLYDVQFSCDPFSL
VVRRKSTGQTLLNTTLAPLIFADQFLQISTSLPSGYLYGLGEHYIALNLSLQWNRLTFWN
RDLRPSKDSNLYGSHPFYLSMEKGGSAHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFY
VFLGPEPKSVIRQYQDVIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKFPLDV
QWNDIDYMDAMRDFTYDANRYGDFPEMVKEFHQQGMKYIMIVDPAISSSNTPGSYPPYDD
GLKRGVFITDDKGKPLVGKVWPGLTVFPDFTNPETFSWWYDMVTLFHDQVPFDGMWIDMN
EPSNFVKGSVNGCPNNELENPPYVPGVVGGSLSSTTICASSQQHLSSHYNLHNLYGLSEA
VATYYALIKVLKKRPFIISRSTFASHGHYAGHWTGDVVSSWEQLYYSVPAILRFNMFGVP
MVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDQDSVSQEPYVFSGEAQSAIKSALL
IRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQFLWGEALLITPVLEQGK
TEVNAYLPIGTWYAPELGTGIESKGQWMVLPAPLDKINFHIRGGYILPAQMPGMNTEESR
KNDLLLVVALNPDGVARGDLYWDDGESLGTFERQDYTHVLFIAANNVLLNELIRLNSQAD
GLKLGLVTVYGVPSPPKKVLVNGIASEDYSYTLDTKVLVIMNLSLPIVQEFVITWTL
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgccgggctccttgggcaggagtggaagttctgaaggttcagtatggagtctg
ttaatgcttcttttgctttctgctgtatgttctggagccccatcacaagaaacccagccc
agccctttgcagtgtaatttgtcccccaacagccgattcgactgtgccccagaaaagatt
gtcagtaaggaagagtgtgaggctcgtggctgctgttactctccagcagaacataacggg
aatattgggcagccatggtgcttttatcccccaagctatcccagttacaagatggacaat
ttaacccagacggatagaggatacagtgccaccctcaagcgttccatgggtacgttcatg
cctcgtgatataatgaccttgcagctggaagttttcttcgagacagagagtagactccat
tttactatcaaagatcctgctgagaaacgctatgaggttccaatacccactccgcaggtc
catggcaaggcacccaatacactctacgatgtccaattttcctgtgacccttttagtttg
gtcgttcgcagaaagtccaccgggcaaactttgttgaacaccactctggctccactgata
tttgcagatcagttcttgcagatctcaacatcccttccctctggttatctgtacggtctg
ggggaacactatattgctcttaatctcagccttcagtggaatcgcctcactttttggaac
agagatttgagaccttcaaaggattctaacttgtatgggtctcatccattctacctgtcc
atggagaaaggtggctcagctcatggggtgttcctgttaaacagcaatgctatggatgta
ttattgcaggaagctccagctctgacctggagaactaccggaggaatcttggatttctat
gtattccttggacctgagccaaaatccgtgattcgacagtatcaggatgttattggatat
ccatttatgcctccctactggagtcttgggttccacctttgccgttgggggtattcaacg
tcaaattgcactcgacaagtggtgaaaaatatgagggatgcaaaatttccactggatgtg
cagtggaatgatatcgattacatggatgccatgcgagactttacatacgatgcaaacaga
tatggggattttccagagatggtgaaagagttccaccaacagggcatgaaatacatcatg
attgtggacccagccatcagcagctccaacacacctgggagttacccaccatatgatgat
ggcctgaagagaggagtgtttatcactgatgataaaggaaaacctcttgtaggaaaggtc
tggcctggcctcactgtgtttcctgattttacaaatccggagacatttagctggtggtat
gacatggtgacacttttccatgaccaagtgccttttgatgggatgtggattgacatgaat
gagccctcaaactttgtcaagggctcggtaaatggatgccccaacaatgagctggagaac
cctccctacgttcctggggtagttggaggctcacttagttccaccaccatctgtgcctcc
agtcagcagcatttatcctcacactacaaccttcacaatctctacggactctctgaggca
gtggctacctactatgctctgattaaagttctgaagaagcgtcccttcatcatttctcgc
tcaacatttgctagtcacggtcactatgctggccactggactggagatgtggtgagcagt
tgggaacagctttattactctgtaccagccatactcaggttcaacatgtttggtgttccg
atggtaggagcagatatctgtggatttgggggtaacactacagaggagctctgtgtgcgc
tggagccaactgggagccttttatccttttatgagaaaccacaatgatcaagattcagtg
tcacaggagccgtacgtgttcagcggtgaagcacagagcgctataaagtcggccttgctt
attcgctacacgctccttccgtatctctacaccctattccacaaggctcacagttctggg
gagaccgtggccagagctctttttatcgagtttcccactgatccaaacacgtggacaatt
gaccggcagtttctttggggggaggctttactgatcacgcctgttttggagcaggggaaa
actgaagtaaatgcatacctccctattggaacgtggtatgctcctgaattgggcacaggg
attgagagtaaaggccaatggatggtgcttcctgctccactagacaagatcaattttcac
ataagaggaggttatatcttacctgcccagatgcctggtatgaacacagaggagtctcgc
aagaatgacctgctgctagtggtggcactaaaccctgatggagttgcccgcggtgacttg
tactgggatgatggtgaaagtttgggaacatttgagagacaggactacactcacgttctc
ttcatagctgcaaataatgtcctgctgaatgagctcatccggctgaacagtcaggcagat
ggtttaaaactgggactggtgactgtttatggggtgcccagcccccctaaaaaagtcctg
gtaaatggcattgcgagtgaagattactcttacaccttagatacaaaggtgctggttata
atgaacctttctttgcctatagtacaagagtttgtgatcacatggactttatag

DBGET integrated database retrieval system