KEGG   Xenopus laevis (African clawed frog): 108703451
Entry
108703451         CDS       T01010                                 

Gene name
tp53.S, Trp248, Xp53, Xrel3, p53
Definition
(RefSeq) tumor protein p53 S homeolog
  KO
K04451  tumor protein p53
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04137  Mitophagy - animal
xla04210  Apoptosis
xla04216  Ferroptosis
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108703451 (tp53.S)
   04310 Wnt signaling pathway
    108703451 (tp53.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108703451 (tp53.S)
  09143 Cell growth and death
   04110 Cell cycle
    108703451 (tp53.S)
   04210 Apoptosis
    108703451 (tp53.S)
   04216 Ferroptosis
    108703451 (tp53.S)
   04115 p53 signaling pathway
    108703451 (tp53.S)
   04218 Cellular senescence
    108703451 (tp53.S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108703451 (tp53.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108703451 (tp53.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    108703451 (tp53.S)
   03400 DNA repair and recombination proteins [BR:xla03400]
    108703451 (tp53.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    108703451 (tp53.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108703451 (tp53.S)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108703451 (tp53.S)
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 108703451
NCBI-ProteinID: XP_018095069
Xenbase: XB-GENE-17346471
LinkDB
Position
5L
AA seq 375 aa
MLCSLDSRDSRGFGRYLVGILKITQVLHQIVAALLFPRLPDPLQTGTCRLDNLPEFPDYS
LAPDMTVLQEGLMVNAVPTVTSAAVPSTEDYAGSYGLKLEFQQNGTAKSVTCTVSPKLNK
LFCQLAKTCPLLVRVATPPPCGSILRATAVYKKSEHVAELVKRCPHHERSVEPTDDAAPP
SHLMRVEGNPQAYYEEDAGSGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGMNRRPI
LTIITLETPQGLLLGRRCFEVRVCACPGRDRRTEEQNDMKKRGLKANGKRELPHSPSTQA
PLPKKRLVVVDDDEEIFTLRIKGRSRYEMIKKLNDALELQESLDQQKVTIKCRKCRDEMK
PKKGKKLLVKEPDSE
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgctttgctctctcgactctcgggatagtcggggcttcggtcgctatctcgtgggcatt
ttgaaaatcacacaagtgctccatcaaattgtggctgctctgcttttccccaggttgccg
gaccccctgcagactgggacgtgccggctggacaacctgccagagtttccagactattct
ctggctccagacatgacggtgctacaggaggggcttatggttaatgctgttcccacggtg
acttcggctgctgtcccctcaactgaggattatgctgggagttatgggctgaaactggag
ttccaacagaacggaaccgcaaagtctgttacctgcacggtgagtcccaagctcaacaaa
ctcttctgccagttggccaagacttgccctttgttggtgcgtgtggccacccccccgccg
tgcggctccattctccgggctacggccgtgtacaagaagtctgagcatgtggctgagctg
gtgaagagatgcccccaccatgagcgcagcgtggagcccaccgacgatgctgcccccccc
agtcacctgatgcgagtggaggggaacccccaggcttattatgaggaggatgctggtagc
ggacgccatagtgtgtgtgtgccgtatgaggggcctcaggttggaacggaatgtacaaca
gttctgtacaattatatgtgtaacagctcctgtatgggagggatgaaccgccggcccatt
ctcaccatcatcaccctcgagaccccacaggggctgcttctgggccggcgctgttttgag
gtgcgagtttgcgcctgtcccgggagggatcgtcgtacagaggaacaaaatgacatgaag
aagaggggcctgaaagccaatgggaagagagagctccctcactcaccctccactcaagct
ccacttcctaagaagcggctcgttgtcgttgatgatgatgaagagatcttcactttacgg
atcaaggggcgcagccgctatgagatgattaagaaactgaatgacgcacttgaattacag
gagagtctggatcagcagaaagtgaccataaagtgccgcaagtgccgggatgaaatgaaa
cccaagaaggggaagaagctgctggttaaagagcccgactctgaatga

KEGG   Xenopus laevis (African clawed frog): 397926
Entry
397926            CDS       T01010                                 

Gene name
tp53.L, Trp248, Xp53, Xrel3, p53, tp53
Definition
(RefSeq) tumor protein p53 L homeolog
  KO
K04451  tumor protein p53
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04137  Mitophagy - animal
xla04210  Apoptosis
xla04216  Ferroptosis
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397926 (tp53.L)
   04310 Wnt signaling pathway
    397926 (tp53.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    397926 (tp53.L)
  09143 Cell growth and death
   04110 Cell cycle
    397926 (tp53.L)
   04210 Apoptosis
    397926 (tp53.L)
   04216 Ferroptosis
    397926 (tp53.L)
   04115 p53 signaling pathway
    397926 (tp53.L)
   04218 Cellular senescence
    397926 (tp53.L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    397926 (tp53.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    397926 (tp53.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    397926 (tp53.L)
   03400 DNA repair and recombination proteins [BR:xla03400]
    397926 (tp53.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    397926 (tp53.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     397926 (tp53.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    397926 (tp53.L)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 397926
NCBI-ProteinID: NP_001081567
Xenbase: XB-GENE-6252168
UniProt: P07193
LinkDB
Position
3L
AA seq 363 aa
MEPSSETGMDPPLSQETFEDLWSLLPDPLQTVTCRLDNLSEFPDYPLAADMTVLQEGLMG
NAVPTVTSCAVPSTDDYAGKYGLQLDFQQNGTAKSVTCTYSPELNKLFCQLAKTCPLLVR
VESPPPRGSILRATAVYKKSEHVAEVVKRCPHHERSVEPGEDAAPPSHLMRVEGNLQAYY
MEDVNSGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGMNRRPILTIITLETPQGLLL
GRRCFEVRVCACPGRDRRTEEDNYTKKRGLKPSGKRELAHPPSSEPPLPKKRLVVVDDDE
EIFTLRIKGRSRYEMIKKLNDALELQESLDQQKVTIKCRKCRDEIKPKKGKKLLVKDEQP
DSE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggaaccttcctctgagaccggcatggacccccccctcagccaggagacattcgaggat
ctgtggagtctgttgcctgaccccctgcagactgtcacgtgtcggctggacaacctatca
gagtttccagactatcccctggcagcagacatgacggtcctacaggaggggcttatgggt
aatgctgttcccaccgtcacttcatgtgctgtcccctcaactgacgattatgctgggaag
tatgggctccaactggacttccaacagaacggcaccgcaaagtctgttacctgcacgtat
tccccagagctcaacaaactcttctgccagttggccaagacttgccctttgctggtgcgt
gtggagagccccccgcctcgcggctccattctccgggctacggccgtctacaagaaatct
gagcatgtggccgaggtggtgaagagatgcccccaccatgagcgcagtgtggagccaggg
gaggatgctgcgcctcccagtcacctgatgcgagtggagggaaatctccaggcttattat
atggaggatgtaaatagcgggcgccatagtgtctgtgttccctatgaggggcctcaggtt
ggaacggaatgtacaacagttctgtacaattatatgtgtaacagctcctgtatgggaggg
atgaaccgccggcccattctcaccatcatcaccctcgagaccccacaggggctacttctt
ggccgccgctgttttgaggttcgagtgtgtgcctgcccagggagggatcgtcgcacagag
gaagacaattacacaaaaaagaggggcctgaaacccagcggcaagagagaacttgctcac
ccaccatccagtgaaccaccacttcctaagaagcgtcttgttgttgttgatgatgatgaa
gaaatcttcactttgcggattaaggggcgcagccgctatgagatgattaagaaactgaat
gacgcacttgaattacaagaaagcctcgatcagcagaaagtgaccattaagtgccgcaag
tgccgggatgaaatcaaacccaagaaaggaaagaagctgctggttaaagatgaacagccc
gactcggaatga

DBGET integrated database retrieval system