KEGG   Xenopus laevis (African clawed frog): 108704383
Entry
108704383         CDS       T01010                                 

Gene name
bid.L, fp497, xbid
Definition
(RefSeq) BH3 interacting domain death agonist L homeolog
  KO
K04726  BH3 interacting domain death agonist
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108704383 (bid.L)
   04217 Necroptosis
    108704383 (bid.L)
   04115 p53 signaling pathway
    108704383 (bid.L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108704383 (bid.L)
SSDB
Motif
Pfam: BID Bcl-2 U3snoRNP10
Other DBs
NCBI-GeneID: 108704383
NCBI-ProteinID: XP_018096384
Xenbase: XB-GENE-17338535
LinkDB
Position
Un
AA seq 228 aa
MQRHTGNYPLHNALGHSETAETVRESVSSTGRDISAASLYQGRMTLSVEKILLSYLEIDL
KNNEVWEELNLFSGRGMKRGPMRQQGVSMRCCEGDLETDGNVPLKSTDIIQLEEEDEELC
RRIAAQLAEIGDKLEREMKIKPEVVDGLVDAMLNNTLDEEHLAATVQSLVQTAPPGVEQE
LATVAVAMILTKKAVTNAPSLLHNICHTTTQFVERNYRACLERLARQR
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcagagacacacagggaattaccccttgcacaatgctctgggtcactcagagacagca
gagacagtgagggagtcagtgagcagcacagggagagacatcagcgctgcgagtttgtac
cagggaaggatgacactcagtgtagaaaagatccttctctcctacctggagatcgactta
aagaacaatgaagtctgggaggagctgaacttgttttcgggaagagggatgaagcgggga
ccaatgaggcaacagggagtgtcgatgcgttgttgcgagggggatctggaaacggatgga
aatgtcccattaaaatctacagacataattcaattggaagaagaggatgaggagctgtgc
cgcaggattgccgctcagttggcggaaatcggcgataaactggagcgagagatgaagata
aaaccagaggtagtcgacgggctagtggacgccatgctcaataacacgctggatgaggag
catttggcagccacagtccagtcgctggtgcagacagcgcccccgggggtggagcaggag
ttagccaccgtggccgtagccatgatcctgaccaagaaagccgtgaccaacgccccctct
ctgctccacaacatctgccacaccaccacacagttcgtagagaggaactaccgcgcttgt
ttagagcgtctcgcccgacagaggtga

KEGG   Xenopus laevis (African clawed frog): 724076
Entry
724076            CDS       T01010                                 

Gene name
bid.S, bid, fp497, xbid
Definition
(RefSeq) BH3 interacting domain death agonist S homeolog
  KO
K04726  BH3 interacting domain death agonist
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    724076 (bid.S)
   04217 Necroptosis
    724076 (bid.S)
   04115 p53 signaling pathway
    724076 (bid.S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    724076 (bid.S)
SSDB
Motif
Pfam: BID T2SSN Cactin_mid U3snoRNP10 Bcl-2 Baculo_gp41
Other DBs
NCBI-GeneID: 724076
NCBI-ProteinID: NP_001089063
Xenbase: XB-GENE-1188287
UniProt: Q56VD1
LinkDB
Position
3S
AA seq 184 aa
MSLNVKTILVSYLEIDIKNHKDEFWEELSWFAREEGKLVAQMGRNDGDLETDGNVQFRST
GTIVYEGEAEVDEELCRRIATQLAEMGDKLEREMRIKPEVVNGIVDALLNHTLNEEYLAA
TVQSLVQTAPPGVEQELMSVAIALILTKKAVTNVPSLLHNICCTTTHFIERNYRACLERL
ARQR
NT seq 555 nt   +upstreamnt  +downstreamnt
atgagtctgaatgtgaagacgattctcgtctcgtacctggagatcgacataaagaatcac
aaagatgaattctgggaggagctgagctggtttgcgagggaagaggggaagttagtggca
cagatgggaaggaatgatggggatctggaaactgatggaaacgtccaattcagatctaca
ggcacaattgtgtatgaaggagaagcagaagtggacgaggagctgtgccgcaggattgcc
acccagttggcagaaatgggagataaactggagcgagagatgaggataaaaccagaggta
gtgaatggaatagtggatgccctgctcaatcacaccctgaatgaggagtatttggcagcc
acagtccagtcgctggtgcagacggcccccccaggggttgagcaggagttgatgtcggtg
gccatagccctgatcctgaccaagaaagccgtgaccaacgttccctctctgctccacaac
atctgctgcaccaccacgcacttcatagagaggaactaccgcgcttgtttagagcgtctc
gctagacagaggtga

DBGET integrated database retrieval system