KEGG   Xenopus laevis (African clawed frog): 108704565
Entry
108704565         CDS       T01010                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04260  Cardiac muscle contraction
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108704565
   04020 Calcium signaling pathway
    108704565
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108704565
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108704565
   04261 Adrenergic signaling in cardiomyocytes
    108704565
   04270 Vascular smooth muscle contraction
    108704565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108704565
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108704565
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel Gag_p17
Other DBs
NCBI-GeneID: 108704565
NCBI-ProteinID: XP_018096635
LinkDB
Position
Un
AA seq 2133 aa
MVNENERMYIPEGDHPGSNYTNPLPALGTMNSTPGLATEHIASPGAALSWQAAIDAARQA
KLMGSTVNATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVE
WKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYG
LLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVL
RPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYFLT
NGYPEEEPSPCALESNNGRHCANGTVCRSGWAGPKHGITNFDNFAFAMLTVFQCITMEGW
TDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLR
EKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSMPASETESVNTDNVGSGDVE
EESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEH
YNQSDWLTEVQDTVNKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETIL
VETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIF
SLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFP
GMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPE
KKQENESIGKSPVPAVEENKEKIELKAITADGETPPATKISVEEFSSNENDEKSPYPSSN
ETPAEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFIFRADNRFRLHCHRIVNNN
IFTNLILFFILLSSISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLHFSPMQGKLYSCTDSSKITEEECKGKYISYKDGDVSQPMIV
DRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFI
IYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ
YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMI
LKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNHYFCDAWNTFDALIVVGSIVDIA
ITELNPGEHAQCSSSMNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQA
LPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ
EIMLACLPSKPCAPESETSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
AMNMPLNSDGTVMFNATLFALVRTSLCIKTDGNLEQSNEELRAIIKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKLSQKNALSLQAGLRTLHDIGPE
IRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQSEVRSAFPQTFTT
QRPLHINKTSGGPGDLDSPSHEKLVDSTFTPSSYSSSGSNANINNANNTALVRLPCYRTT
VSTVEGQSRPVAPRGSWKLASKSSVSRDSRLPIICREEASQDETYDASEEVEYNSEPSLL
CSEMFSDRDEESRQLTPSEVEVERGLCPSPKKGFLRSASLGRRASFHLECLMRYRHQGAE
TSSPKTVLPQLHLLHHQALAVAGLSPLLRRSHSPTAFSRLCSTPPATPCPRGGWTQQTVP
TLRLHGEPGSRENLNSSFPSIHCSDCSIGRNRPASLTVPSHPREQSRQHHGSASSLVEAV
LISEGLAQFAQDPRFLQVATHELADACDMTIEEMETAADSFLNGKASPNGKPFSNGRDQG
LDCAGGGSEETGLSPECQDSDEQEDCRVYVSSL
NT seq 6402 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacgagaggatgtacattccagaaggagaccacccaggttccaactac
accaacccactgccagcccttggcaccatgaactctaccccgggcctggcaacagagcac
attgcctctccaggtgctgctttgtcctggcaggccgccattgatgcagcacgccaggcc
aagcttatgggcagcacggttaacgccaccatatccacggtcagctccacgcagaggaag
aggcagcaatacagcaagcagaaaaagcaagggaccaccacagccacaaggcctccccgg
gcgttgctttgtttgaccctgaaaaaccccatccgccgagcctgcatcagtatcgtggaa
tggaaaccgtttgaaattattattttactgactatctttgccaactgtgtggccttagct
gtctacatccctttcccagaagacgattccaacgctacgaactccaatctggaacgggta
gaatatctcttcctcatcattttcacagtggaagccttcctaaaagtcatcgcatatggg
cttctgttccaccccaacgcttacctccgaaacggctggaatctgctggatttcataatt
gtagtagtagggctttttagtgctattttagagcaggccacaaaggcagatgggggcagc
gccattggagggaaaggagccggatttgacgtgaaagctcttcgggcgttccgtgtcttg
agacccctaaggctggtgtctggagtccccagtctccaggtggtgctgaattccattatt
aaggcaatggttccgctgctgcacatcgctttgctggtgctgtttgtcattattatctat
gctataatcgggctggagctgttcatgggcaaaatgcacaagacctgctacttcctgaca
aatggatatccagaggaagaaccctcaccgtgtgcattggagagcaataatgggcggcat
tgtgccaacggcactgtgtgcagatctggttgggcgggacccaaacacggcatcactaat
ttcgacaactttgcatttgccatgctcactgtcttccagtgcatcaccatggagggctgg
acagatgtgctttactggatgcaggatgcaatgggatatgaactgccctgtgtgtacttt
gtcagcctcgtcatctttggatcatttttcgttctgaacctggttcttggtgttctgagt
ggtgagttttccaaagagagagagaaggccaaggctcggggcgacttccaaaagctgagg
gagaagcagcagctggaggaggacctgaaaggctacttggactggatcactcaggctgaa
gacatcgacccagagaatgaagatgaagatatagatgaagagaaacctcgaaacatgagc
atgccagccagtgaaacggagtcggttaacacagataatgtgggcagtggagacgtggaa
gaggagagctgcggagtgcgccttgcgcacaggatttccaagtctaaatttagtcgatac
tggcggagatggaaccggttttgcagaaggaagtgtcgggctgctgtcaaatccaacgtc
ttttattggctggttatatttcttgtgtttctgaacacgctgaccattgcttcagagcac
tataaccaatctgattggcttactgaggtgcaagacacagtcaacaaagtgctcctggct
cttttcacagcagagatgcttctcaaaatgtacagccttggccttcaagcctactttgtt
tccctgtttaatcgctttgactgcttcattgtgtgcggtgggatcttggagaccatattg
gtagaaactaagatcatgtcacccctggggatctctgtcctgcgctgtgtgcgccttctc
aggatattcaagattaccaggtactggaactctctgagtaatcttgtggcctcgctgctg
aattccgtgcgttccatcgcttcccttctcctccttctcttcctcttcatcatcatcttc
tcccttctggggatgcaactctttggtggcaaatttaactttgacgagatgctgacccgc
aggagcacgtttgataactttccacaggctttgcttaccgtgtttcagattcttactgga
gaggactggaactcagtaatgtatgatgggattatggcgtatggtggaccctcctttcct
gggatgcttgtgtgcatttattttatcatcctcttcatctgtggaaactatattcttctg
aatgtcttcttggccattgctgtggacaacctggctgatgccgagagtctcacctctgct
cagaaagaagaggaagaagagaaggagaggaagaaactggcaagaactgctagccctgag
aagaaacaagaaaatgagtccataggaaagtctccagtgcctgctgtggaggagaacaaa
gagaagatagaactgaaggccatcacagcagacggggagactccacccgccaccaagatc
agtgtggaagaattttcctccaatgagaatgatgagaagagtccatatcccagctccaat
gagaccccagctgaagaggaagaagaagagcctgagatgcctgttggccctcgcccaagg
cccctttcggaactgcacatcaaagaaaaagctgccccaatgcccgaagcttctgccttc
ttcatatttcgagctgataacaggttccgcctccactgccacagaatagtcaacaataac
atcttcaccaacctcatcctcttctttatcctcttgagcagcatctccctggcagcagaa
gaccctgtgcgacacaactccttcaggaaccaaatcctaggaaatgctgattatgttttc
actagtatctttactttagaaataatcctcaagatgacggcctatggggctttcttacac
aaaggctccttctgcaggaactacttcaatattttggatcttctggtggtcagcgtttcc
ctcatctcattcggaattcagtccagtgccatcaacgtggtgaagatcttgcgagtactg
agggtgctgaggcctctcagagccatcaacagagccaaggggctaaagcacgtggtacag
tgcgttttcgtggcaatccgcaccattggtaacatcgtcattgtcaccactctgctgcat
ttctctcccatgcagggtaaattgtacagctgcactgacagctccaagattacagaggaa
gagtgcaaagggaagtacatcagctataaggatggggacgtctcgcagcccatgatagtg
gatcggagctgggaaaacagcaagtttgactttgataatgttctgtcagcaatgatggcc
ctcttcactgtctccacatttgaggggtggccggagcttctctatcgtgccatcgactcc
cacacagaagacgtgggtcccatctacaaccaccgcgtggagatctccatctttttcatc
atctacatcatcatcattgccttcttcatgatgaatatctttgtgggtttcgtcatcgtc
acgttccaggagcagggggagcaggagtacaaaaactgtgagctggacaagaaccagcgt
cagtgtgtggagtatgccctgaaagcccggcccctgagaagatacatacccaaaaaccag
taccagtacaaagtctggtatgtggtcaactccacctactttgaatacctcatgttcgtg
ctcatcttactcaacaccatctgtctcgccatgcagcactacgggcagagctgttccttc
aaggaagccatgaacatcctaaacatgttgttcacggggctcttcactgttgagatgata
ctgaagctcattgccttcaaaccaaagggttattttagtgacccttggaatgtctttgac
tttctcatcgttattggcagcgtagttgacgtcattctcagcgagaccaatcactatttc
tgtgatgcatggaacacatttgatgcactgatagtagtgggtagcattgttgatatagca
atcaccgaactcaacccaggtgaacatgcccaatgctcctcctctatgaatgtcgaggag
aattcccgcatctccatcaccttcttcaggctattccgagtcatgaggcttgtgaagctt
ctcagtcgtggagaagggatccggactctgctatggaccttcatcaagtctttccaggct
ctcccctatgtagcactgcttattgtcatgctgttctttatctacgccgtcattggcatg
caggtttttgggaaaattgcgctgaatgacaccactgaaatcaacaggaacaataatttt
cagactttccctcaggcagttctgctcctcttcagatgtgccacaggtgaagcgtggcaa
gagataatgctcgcctgcctccctagtaagccgtgtgcccctgaatccgaaaccagcgaa
gaaaaatgcggcagcagctttgccgtcttctattttatcagcttctacatgctctgcgcc
ttcttgatcattaatctgtttgttgcagtcattatggataattttgactatctgacacgg
gattggtccatattgggccctcatcatttggatgaatttaaacggatttgggcagagtat
gatccagaagccaaggggcgcatcaagcatctagatgttgtgaccctactgaggaggatt
cagcccccattgggatttgggaagctgtgcccacatcgggtggcatgcaagcgcctagtg
gctatgaacatgccgctgaatagtgatgggacagtcatgtttaatgcaacactctttgcc
ctagtaaggacatctttgtgcatcaaaacagatgggaacctggaacagtccaatgaagag
ctgagagccatcatcaaaaagatatggaagagaaccagcatgaaacttttggaccaggtg
gtgcccccagctggagatgatgaggtcacggtgggaaagttctatgccaccttcctgatc
caggaatatttccggaaattcaaaaaacgcaaggagcaaggacttgtgggtaaactttcc
cagaaaaatgcactgtcattgcaggccggcctgcgcactctgcacgacattggccccgag
atccgcagagctatttctggggacctgacagccgaggaggagctggacaaggccatgaag
gaggctgtgtctgctgcatctgaggatgacatctttaggagagctggaggactatttggg
aaccacgttggttattaccagagtgaagtccggagtgcgtttcctcagaccttcactacc
cagcggcctctgcacatcaacaagacgtcgggcggcccaggggatttggactctccttcc
catgagaagctggtggattctacattcacccccagcagctactcttcctccggctccaac
gccaacatcaacaacgccaacaacacggccctggtgcgtctgccctgttaccggactacc
gtgagcaccgtggagggacagagccggcccgtggccccccgtggctcctggaaacttgcc
tctaagagctcagtgtccagagacagccgcctgcctataatctgccgggaggaggcctct
caggatgagacgtatgacgccagcgaagaggtggaatataacagcgagcccagcctgttg
tgctctgaaatgttctccgatcgggatgaggaaagtcggcagctgaccccgtcggaggtg
gaagtggagagggggctttgcccgtcccctaagaaaggttttctgcgctcagcttcttta
ggaaggagagcgtcgttccatttggagtgtctgatgaggtatcggcaccagggggcggaa
acgtcgtcgcccaaaacggtgctgccgcagcttcatctgttgcaccatcaggcgttagca
gtggcaggtctcagccctttactaaggcggagtcactcgcccacagccttctcacgtctc
tgttccacgccgcctgccaccccatgcccccgaggaggctggacgcagcaaactgtgcca
acgttacggcttcatggagagccaggctctcgggaaaacctgaatagtagcttcccttcc
atccactgcagtgactgtagtatagggcgtaatcgccctgcctcccttacagtcccctcc
cacccacgggagcaaagcaggcagcaccatggcagcgccagcagtttagtagaagcggtg
ctgatctctgaagggctggcacagtttgctcaggacccccgcttcctccaggtggcgaca
catgagctggccgacgcctgcgacatgaccatagaggagatggagactgctgctgacagt
tttttgaatggcaaggccagccccaacgggaagccattctctaacggcagggaccagggg
ctggactgcgcggggggtgggtcagaggagacaggactctcaccggaatgccaagacagt
gacgagcaggaggactgccgagtgtatgtaagcagcctgtag

DBGET integrated database retrieval system