KEGG   Xenopus laevis (African clawed frog): 108705492
Entry
108705492         CDS       T01010                                 

Definition
(RefSeq) cyclin-dependent kinase 4-like
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108705492
   04115 p53 signaling pathway
    108705492
   04218 Cellular senescence
    108705492
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108705492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108705492
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108705492
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108705492
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POT1PC
Other DBs
NCBI-GeneID: 108705492
NCBI-ProteinID: XP_018097862
LinkDB
Position
Un
AA seq 87 aa
MLYRGFLRRIPVWNMAKEMNGQYEPVAEIGVGAYGTVYKARDLHSGKFVALKNVRVQTNE
NGLPLSTVREVALLKRLEHFDHPNIVK
NT seq 264 nt   +upstreamnt  +downstreamnt
atgctctacagggggttcttgagaagaataccggtgtggaatatggctaaagaaatgaac
gggcagtatgagcctgtcgcagagatcggcgtcggggcttatggcacggtatacaaggcc
agggaccttcacagtggaaagttcgtggccctgaaaaatgtgcgggtgcaaaccaacgag
aatgggctccccctctctactgtcagggaagtggctttattaaaacgcctggagcatttt
gaccatccaaacattgtaaagtaa

KEGG   Xenopus laevis (African clawed frog): 108718479
Entry
108718479         CDS       T01010                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108718479
   04115 p53 signaling pathway
    108718479
   04218 Cellular senescence
    108718479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108718479
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108718479
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108718479
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 108718479
NCBI-ProteinID: XP_018122302
LinkDB
Position
6L
AA seq 292 aa
MMEKDSLADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIRE
VAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPDPGVPNET
IKVPLKSEYIYVYGSFSMIQPMVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKP
LFRGNSDVDQLGKIFDVIGLPEEDEWPHDVAVPRDAFHVRQPVPIDNVVQDIDEQGKDLL
IKCLTFTPANRISAFSALSHPYFHDLQRSKDSVDSHRPSGQKDEGSAGSNTA
NT seq 879 nt   +upstreamnt  +downstreamnt
atgatggagaaggacagtctggccgatcagcagtatgagtgcgtggctgagatcggggaa
ggggcgtatggcaaggtgtttaaggcccgtgacttgaagaatggtggtcgcttcgtggca
ttgaaacgagtgcgggtgcagaccggggaggagggcatgccgctctctaccatcagggaa
gtggcagtgcttcgtcacctggagaccttcgagcatcccaatgtggtcaggttgtttgat
gtatgtacagtttcacggacagacagagagacaaaacttacactggtgtttgaacatgtt
gatcaagatttgaccacttacttggacaaagtaccagatcctggggttccaaatgaaact
attaaggtacctttgaaaagtgaatatatttatgtgtatggctcatttagtatgattcaa
ccgatggtggtcaccttgtggtacagagccccagaagtcttactccagtcaagttacgcc
acgccagttgatctttggagtgttggctgtatatttgcagaaatgtttcggcgaaagcca
ctttttcgtggaaattcagatgtagaccaactaggaaaaatctttgatgtgattggactc
ccagaggaagacgagtggccccatgatgtggctgttccgagggacgccttccatgttaga
caacctgtgcccattgataatgttgttcaagatatagatgagcaaggcaaggacttactt
attaaatgcctgaccttcactccagccaaccgcatctctgcgttcagcgccctgtcccac
ccttacttccatgatttacagagaagcaaagacagtgtagactctcacaggccaagcggc
caaaaggatgaaggttctgctggaagcaacactgcttga

KEGG   Xenopus laevis (African clawed frog): 108719900
Entry
108719900         CDS       T01010                                 

Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108719900
   04115 p53 signaling pathway
    108719900
   04218 Cellular senescence
    108719900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108719900
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108719900
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108719900
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 Kinase-like FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 108719900
NCBI-ProteinID: XP_018124671
UniProt: A0A1L8FQZ7
LinkDB
Position
6S
AA seq 329 aa
MEKDSLADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPMSTIREV
AVLRHLETFEHPNVVRLFDICTVSRTDRETKLTLVFEHVDQDLTTYLNKVPDPGVPNETI
KDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVVVT
LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPKEDE
WPHDVAVARDALHFKQPLPIENVVPDIDEQGKDLLIKCLTFTPANRISASGALSHPYFHD
LQKYKDNVDSHRPSGQKGVDKVSAGNKTN
NT seq 990 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctggccgatcagcagtacgagtgtgtggctgagataggggaaggg
gcgtatggcaaggtgtttaaggcccgcgacttaaagaacggaggtcgttttgtggctctg
aaacgagtgcgggtgcagaccggggaggagggcatgccgatgtctaccatccgggaagtg
gcagtgcttcgtcatctggagaccttcgagcatcccaatgtggtcaggttgtttgatata
tgtacagtttcacggacagacagagagacaaaacttacactggtgtttgaacatgttgat
caagatttgaccacttacttgaataaagtaccagatcctggggtcccaaatgaaactatt
aaggatatgatgttccagcttcttcgaggactggattttcttcattcccatagagtggtg
catcgagacctaaagcctcaaaacattcttgtcaccagcaacggacagataaaactagca
gacttcggccttgccagaatttacagttttcagatggcactcacatcagtggtggtcacc
ttatggtacagagccccagaagtcttacttcagtcaagttacgccacgccagttgatctt
tggagtgttggctgtatatttgcagaaatgtttcggcgaaagccactttttcgtggaaat
tcagatgttgaccaattaggaaaaatctttgatgttattggactcccaaaggaagacgag
tggccccatgatgtggctgttgcaagggacgccttgcattttaaacagcctctgcccatt
gaaaatgttgttccagatatagatgagcaaggcaaggacttacttattaaatgcttaacc
ttcactccagccaaccgcatctctgcatcaggcgctctgtcccacccttatttccacgat
ttacagaaatacaaagacaatgtagactctcacaggccaagcggccaaaagggggtggat
aaagtttctgctggaaacaagaccaattga

KEGG   Xenopus laevis (African clawed frog): 379406
Entry
379406            CDS       T01010                                 

Gene name
cdk4.L, cdk4, xcdk4
Definition
(RefSeq) cyclin-dependent kinase 4 L homeolog
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379406 (cdk4.L)
   04115 p53 signaling pathway
    379406 (cdk4.L)
   04218 Cellular senescence
    379406 (cdk4.L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    379406 (cdk4.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    379406 (cdk4.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     379406 (cdk4.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   379406 (cdk4.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo POT1PC
Other DBs
NCBI-GeneID: 379406
NCBI-ProteinID: NP_001079719
Xenbase: XB-GENE-5900736
UniProt: Q91727
LinkDB
Position
2S
AA seq 319 aa
MSKEMKGQYEPVAEIGVGAYGTVYKARDLQSGKFVALKNVRVQTNENGLPLSTVREVTLL
KRLEHFDHPNIVKLMDVCASARTDRETKVTLVFEHVDQDLKTYLSKVPPPGLPLETIKDL
MKQFLSGLEFLHLNCIVHRDLKPENILVTSGGQVKLADFGLARIYSCQMALTPVVVTLWY
RAPEVLLQSTYATPVDVWSAGCIFAEMFKRKPLFCGNSEADQLCKIFDIIGLPSEEEWPV
DVTLPRSAFSPRTQQPVDKFVPEIDAMGADLLLAMLTFSPQKRISASDALLHPFFADDPQ
ACSKQEHFTHICTATDEVK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtcaaaagaaatgaagggtcaatatgaacctgtcgcagagattggcgtcggggcttac
ggcacggtatacaaggccagggaccttcaaagtggaaagtttgttgccctcaaaaatgtg
cgggtgcaaaccaacgagaatggactccccctctctacggtcagggaagtgactttattg
aaacgcctggagcattttgaccatccaaacattgtaaaacttatggatgtttgtgcttct
gcccgaactgaccgagagactaaagtgacgctggtgtttgaacatgtggaccaagacctg
aagacttacttgagcaaagtcccacctccaggtcttccactggagactattaaggacctc
atgaagcagttcctttcgggcctggaattcctccatttgaattgcattgtgcaccgagac
cttaaaccggagaatatcttggtgacaagtgggggacaggtgaaacttgccgactttggc
ctagcgaggatatacagctgtcagatggctctcacgcccgtggtggtgacgttgtggtac
agggccccagaagtcctgcttcagtccacgtatgccacgccggtagatgtgtggagcgcg
ggctgcatcttcgcagagatgttcaagcgaaaacccctgttctgcggcaattcagaagct
gaccagttgtgcaagatatttgatattattgggcttccttctgaagaggagtggccggtg
gatgttactttgccacgttctgccttttccccgaggactcagcagccagtggacaagttt
gtgccggaaatcgatgccatgggagccgatcttcttctggccatgctgaccttcagccct
caaaaacgtatttccgcctccgatgctctgctccacccctttttcgctgacgatccccag
gcctgctccaaacaagaacactttactcatatctgcaccgcaacggatgaagtgaaatga

KEGG   Xenopus laevis (African clawed frog): 496334
Entry
496334            CDS       T01010                                 

Gene name
cdk6.L, cdk6, plstire
Definition
(RefSeq) cyclin-dependent kinase 6 L homeolog
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    496334 (cdk6.L)
   04115 p53 signaling pathway
    496334 (cdk6.L)
   04218 Cellular senescence
    496334 (cdk6.L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    496334 (cdk6.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    496334 (cdk6.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     496334 (cdk6.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   496334 (cdk6.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo POT1PC
Other DBs
NCBI-GeneID: 496334
NCBI-ProteinID: NP_001088955
Xenbase: XB-GENE-6252089
UniProt: Q5HZQ2
LinkDB
Position
Un
AA seq 319 aa
MAKEMNGQYEPVAEIGVGAYGTVYKARDLHSGKFVALKNVRVQTNENGLPLSTVREVALL
KRLEHFDHPNIVKLMDVCASVRTDRETKVTLVFEHVDQDLKTYLSKVPPPGLPLETIKDL
MKQFLQGLEFLHLNCIVHRDLKPENILVTSGGQVKLADFGLARIYSCHMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSAGCIFSEMFKQKPLFCGNSEADQLCKIFEMIGLPSEEEWPA
DVTLSRSAFSPRTQQPVEKFVPEIDPNGADLLLAMLTFSPQKRVSASDALLHPFFAEDPQ
ACSKQEHFTSIRPMTDDVK
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctaaagaaatgaacgggcagtatgagcctgtcgcagagatcggcgtcggggcttat
ggcacggtatacaaggccagggaccttcacagtggaaagttcgtggccctgaaaaatgtg
cgggtgcaaaccaacgagaatgggctccccctctctactgtcagggaagtggctttatta
aaacgcctggagcattttgaccatccaaacattgtaaaactcatggacgtctgtgcttct
gtccgaaccgaccgtgagactaaagtgacgctggtgtttgagcatgtggaccaagacctg
aagacttacttgagcaaagtcccacctccaggtcttccactggagactattaaggacctc
atgaagcagttccttcaaggactggaattcctccatttgaattgcattgtgcatcgagat
cttaaacccgagaacatcttggtgacaagtgggggacaggtgaaactcgccgacttcggc
ctagcgaggatatacagctgtcacatggctctcacgcccgtggtagtgacgttgtggtac
agagccccagaagtcctgcttcagtccacgtatgccacgccggtagatatgtggagcgcg
ggctgcatcttctcagagatgttcaagcaaaaacccctgttctgcggcaattcagaagct
gaccagttgtgcaagatatttgaaatgattgggcttccttctgaagaagagtggccagcg
gatgttactttgtctcgttctgccttttccccgaggactcagcagccagtggagaagttt
gtgccggaaattgatcccaatggagctgatcttctgctggccatgttgaccttcagccct
caaaaacgtgtctccgcctctgacgctctgctccaccccttttttgcggaggatccccag
gcctgctccaaacaagaacactttacttctatccgccccatgacggatgatgtgaaatga

DBGET integrated database retrieval system