KEGG   Xenopus laevis (African clawed frog): 108706001
Entry
108706001         CDS       T01010                                 

Definition
(RefSeq) RAB6-interacting golgin-like
  KO
K19748  RAB6-interacting golgin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108706001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108706001
Membrane trafficking [BR:xla04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    108706001
SSDB
Motif
Pfam: ANTH MamL-1
Other DBs
NCBI-GeneID: 108706001
NCBI-ProteinID: XP_018098201
LinkDB
Position
Un
AA seq 97 aa
MIIETAIYSYSKYLNRREKSRLDQLQLEQRLMEEKNKRKKALLAKAIAERSKKTQAEVVK
LKRIQTQLQALDDLVSTDIGILRNCIDQACIEFSQAK
NT seq 294 nt   +upstreamnt  +downstreamnt
atgatcattgaaacggccatttatagctactctaaatatctcaacaggagagagaaatct
cggttggatcaacttcaactagaacaacgacttatggaagagaagaataagcgtaagaag
gctttacttgcaaaagctattgctgaaaggtccaaaaaaacccaggcagaggttgtgaaa
ctgaagaggatccagacgcagctccaggctttggatgatttagtatccacggatattggt
attttaaggaactgtattgaccaggcatgcatagaattttctcaagccaagtaa

KEGG   Xenopus laevis (African clawed frog): 108714491
Entry
108714491         CDS       T01010                                 

Gene name
gorab.L, scyl1bp1
Definition
(RefSeq) golgin, RAB6-interacting L homeolog
  KO
K19748  RAB6-interacting golgin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108714491 (gorab.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108714491 (gorab.L)
Membrane trafficking [BR:xla04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    108714491 (gorab.L)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 108714491
NCBI-ProteinID: XP_018114271
Xenbase: XB-GENE-6485798
UniProt: A0A1L8GNL3
LinkDB
Position
4L
AA seq 365 aa
MAGWAGFSEDELRNLKMKQGTELPNQPDRSRRQPTSAKPAAAKSRQQMQRKLALQAQSQQ
LAKQDGSLSVPPEQQLSRPTISSLLSATTCPAEKKQIIPGQPEMSTVVSPGTDLKQQDLC
SEQDGELNKKDMELRDKSRLDHLQLEQRLMEEKNKRKKALLAKAIAERSKKTQAETVKLK
RIQTQLQALDDLVSTDIGILRNRIDQACMEFSHAKKRYEKAEAEYILAKVDFHKKTELKE
QLTEHLCTIIQQNEARKAKKLEELMQQLEVEADEEKLELEIEVEQMLQQQEAEAKKRVAT
QEIQAQVASPTEKNIEPTETSAEKETSSDQNGVCQSSSHLTTESCVQDNSTAQSRPNSLS
DKQPV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctggctgggcaggattctcagaagacgagctgaggaaccttaaaatgaaacaaggc
acagaattaccaaatcaacctgatcgttcacgaagacaacccacatcagccaaacctgca
gcagccaaaagtcgacagcagatgcagagaaagttggctttgcaggcgcagagtcagcaa
ttggctaagcaggatggatccctttctgttccccctgagcagcagctttccaggccaacc
atcagctcattattaagtgcaacaacctgcccagctgaaaaaaagcaaatcatacctggt
caaccagaaatgagcacagtggttagccctggcactgacctcaagcagcaggatttgtgt
tctgaacaagatggagagctaaacaaaaaggatatggaattgagagacaaatctcggttg
gatcatcttcaactagagcaacgtcttatggaagagaagaataagcgtaagaaggcatta
cttgcaaaagctattgctgaaaggtccaaaaaaacccaggcagagactgtgaaactcaag
aggatccagacgcagctccaggctttggatgatttagtatccactgatattggaatttta
aggaaccgtattgaccaggcatgcatggaattttctcatgccaagaagcgttacgaaaaa
gctgaagcagaatatattctggctaaggttgactttcataagaagactgagctcaaggaa
cagttaaccgagcatctgtgcaccataatacagcagaatgaggcccgtaaagccaaaaaa
ttagaggagcttatgcagcagctagaagttgaagctgacgaggagaaacttgaacttgaa
attgaagtagagcagatgctgcagcagcaagaggcagaagcaaaaaaacgagtagcaacc
caagaaattcaagcgcaagtagcttcaccaacggaaaagaatattgaaccaacagaaaca
agtgcagaaaaagaaaccagttcagatcagaatggtgtgtgccagtcctcatcccatcta
acaaccgagtcttgtgtccaagataatagcacagctcagtcaagacctaattccttgtct
gataagcaaccagtatga

KEGG   Xenopus laevis (African clawed frog): 108715743
Entry
108715743         CDS       T01010                                 

Gene name
gorab.S, scyl1bp1
Definition
(RefSeq) golgin, RAB6-interacting S homeolog
  KO
K19748  RAB6-interacting golgin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108715743 (gorab.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108715743 (gorab.S)
Membrane trafficking [BR:xla04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    108715743 (gorab.S)
SSDB
Motif
Pfam: MRC1 DUF4435
Other DBs
NCBI-GeneID: 108715743
NCBI-ProteinID: XP_018116660
Xenbase: XB-GENE-17336838
UniProt: A0A1L8GGV2
LinkDB
Position
4S
AA seq 165 aa
MDTILLAIGFCLKRYDKAEAEYILAKVDLHKKTEIKEQLTEHLCTIIQQNELRKAKKLEE
LMQQLEVDADEEKLELEIEVEQMLQQQETEAKRQLVATQQTQVQVDSPTEKNVEPPEKEK
SAEKEASSDQNGPCQSSPHLTNESCVQDKSTAKSEPNSLSDKQPV
NT seq 498 nt   +upstreamnt  +downstreamnt
atggatactattctgctggcaatcggtttttgtttgaagcgttatgataaagctgaagca
gaatatattctggccaaggtggatttgcataagaagactgaaatcaaggaacagttgaca
gagcatctgtgcaccataatacagcagaacgagctccgcaaagccaaaaaattagaggag
cttatgcagcagctagaagttgacgctgacgaggagaagcttgaactcgaaattgaagta
gagcagatgctgcagcagcaagagacagaagcaaaaagacaactagtagcaactcaacaa
actcaagtgcaagtagattcaccgaccgaaaaaaatgttgagccaccagaaaaagaaaaa
agtgcagaaaaagaagcaagttcagatcagaatggtccgtgtcagtcctcacctcatctg
acaaatgagtcttgtgtccaagataaaagcacagctaagtcagaacctaattccttatct
gataagcaaccagtataa

KEGG   Xenopus laevis (African clawed frog): 108715744
Entry
108715744         CDS       T01010                                 

Definition
(RefSeq) RAB6-interacting golgin-like
  KO
K19748  RAB6-interacting golgin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108715744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108715744
Membrane trafficking [BR:xla04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    108715744
SSDB
Other DBs
NCBI-GeneID: 108715744
NCBI-ProteinID: XP_018116661
LinkDB
Position
4S
AA seq 138 aa
MSGWQGFSEEELRNLKMKQELPHQPDHSRRQPTSAKPAAAKSRRQMQRKMALQAQSQQLA
KQNGSLSVPPEQQLSRPTSSSSPNVISCPVEKKQIIHGQPQMSTSVSSGTDHKEEDLCSE
ENEELNKKEMELLVSLFY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtctggctggcagggattctcagaagaggagcttaggaacctgaaaatgaaacaagaa
ttaccacatcaacctgatcattcaagaagacaacccacatcagccaaacctgcagcagcc
aaaagtcgacggcagatgcagagaaagatggctttgcaagcacagagtcagcagttggct
aagcagaatggatccctttctgttccccctgagcagcagctttccagaccaaccagcagc
tcatcaccaaatgtaatatcctgcccagttgaaaaaaagcaaatcatacacggacaacca
caaatgagcacatcagttagctctggcactgaccacaaggaggaggatttgtgttctgaa
gaaaatgaagagctaaacaaaaaggaaatggaattgttagtaagtctgttttattaa

DBGET integrated database retrieval system