KEGG   Xenopus laevis (African clawed frog): 108706592
Entry
108706592         CDS       T01010                                 

Gene name
pdgfra.S, pdgfr-alpha, pdgfr2, pdgfralpha
Definition
(RefSeq) platelet-derived growth factor receptor, alpha polypeptide S homeolog
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04144  Endocytosis
xla04510  Focal adhesion
xla04540  Gap junction
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108706592 (pdgfra.S)
   04020 Calcium signaling pathway
    108706592 (pdgfra.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108706592 (pdgfra.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108706592 (pdgfra.S)
   04540 Gap junction
    108706592 (pdgfra.S)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108706592 (pdgfra.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108706592 (pdgfra.S)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xla04090]
    108706592 (pdgfra.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108706592 (pdgfra.S)
Protein kinases [BR:xla01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108706592 (pdgfra.S)
CD molecules [BR:xla04090]
 Proteins
  108706592 (pdgfra.S)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C1-set C2-set_2
Other DBs
NCBI-GeneID: 108706592
NCBI-ProteinID: XP_018098632
Xenbase: XB-GENE-17335238
UniProt: A0A1L8HLA2
LinkDB
Position
1S
AA seq 1090 aa
MMPTTRASLILGCLLIIGPWVILAEHPLPSIFPPKDELVQRLHSSFSLTCNGESELSWQH
PYSDPRAEEHNVAIRNEENNSGRFVSVLEVTNASASNTGLYTCYHNHTQTEEGEIEGTDI
YIYVPDPNVPFAPPGIFDHIIVVEEDESALVPCRTTDPSSQVTLKNMENSRIVNAFYDRK
QGFAGNFPPGSYICETVSNKMVYQTEAYILQTWKATHNISVEMEAPKTVFRAGETITIAC
IVLDNEVVDLQWAYPGQQRGVGSRNVEESKVPYQRLVYTLNIANATAKDSGEYECAVIHA
TLDNMVVKKTNITVHEKGFINLEPMFGSEEFANLHEVKSFIVDLHAYPTPRVFWLKNNRT
LSENLTEITTSTVTTKETRLQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFVLQIKVPA
LILELVDEHHGTSGEQTVGCLAKGMPVPDVEWLVCKDIKRCSNDTWWSLLAINGSEISME
THQDDENTIESQVTFKKVEETMAIRCVAKNDLGVAARELKLVAPTLRSELTVAAAVLVLL
VIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVL
GRILGSGAFGKVVEGTAYALSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHL
NIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKPKKDLDIFGLNPADE
STRSYVILSFENNGDYMDMKQADTMQYVPMLEMNEPSKYSDIQRSLYDRPASYKKKPLSE
VKNILSDDGFEGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICDF
GLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPYP
GMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESLLPME
YKRCYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNEHKMKDRESGFDEQRLSADSGY
IIPLPDIDPVSDDESGKRNRHSSQTSEESAIETGSSSSTFIKRDDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgatgcctaccacgagggcatcacttattctggggtgtctcctgattataggcccgtgg
gtaattcttgctgaacatcctctgccctcgatatttcccccaaaggatgagttggttcag
aggttgcactcctccttttcattaacgtgcaatggtgaaagcgaactgagctggcagcac
ccttattccgatccgagagccgaggagcacaatgtagccattcgaaatgaagaaaacaac
agcggccgctttgtgtctgttctggaagtgaccaacgcttctgcctccaatacgggcctc
tacacctgctaccacaatcacactcagactgaggagggtgagattgaaggcacagatatc
tatatctatgtcccagaccctaacgttccttttgctccccccgggatctttgaccatatt
atagtggttgaggaagatgagtctgctttggtaccttgtcgcactaccgacccttcaagc
caagtgaccctaaaaaatatggaaaattctagaattgtcaatgccttttatgacagaaag
caaggatttgctggaaacttcccaccaggatcgtacatctgtgaaaccgtctccaacaaa
atggtctatcagacagaagcttatattttacagacatggaaagcaactcacaacatttct
gttgaaatggaagctcccaagactgtgttccgagctggggaaaccattactattgcctgc
attgtgctggacaatgaggtggtagacttgcagtgggcctaccctggacaacagagaggg
gttggcagtagaaatgttgaagaaagcaaggttccctatcagcggctggtatacacctta
aacatcgcaaatgccacggcaaaagattctggagagtacgagtgtgctgttatacacgca
acactagataacatggtagtcaagaagacaaacataacagtccatgaaaaaggattcatc
aacctggagcccatgtttggatcagaggaatttgctaatctccatgaagtcaagagtttt
atagtagacttgcatgcatatcccacccctagagtcttctggctgaagaacaaccggaca
ctgagtgaaaatctgacagagatcacaactagtactgttacaactaaagaaaccaggtta
cagagtaaacttaagctgatccgggccaaagaagaagacagtgggctgtatactctggtg
gcacaaaatgatgcagaaactaaaagttactcgtttgtgttacagataaaagtacctgct
ttgatattggaactggttgatgagcatcatgggacatctggtgaacagactgttgggtgt
ttagccaaaggaatgccggtccctgatgtggaatggttggtctgcaaggacattaaaaga
tgcagcaatgacacctggtggtcccttctggcaataaatgggtcagaaatcagtatggag
acgcatcaagatgatgagaacacaattgaaagccaggtgactttcaagaaagttgaggag
acaatggcaatccgatgtgttgcaaaaaatgaccttggtgttgcggccagggaactaaag
ctggttgcacctaccctacgttctgagctcactgtggctgctgctgtcttggttcttctg
gtgattgtcattatatccctcattgtacttgtcatcatatggaaacagaaaccaaggtac
gaaataagatggcgagtaattgaatctatcagcccagacggccatgaatatatctatgtt
gatccaatgcagcttccttatgactcccggtgggaattcccaagggatggacttgttctt
ggtcgcatccttggctctggagcttttgggaaagtggttgaaggcacagcatatgcatta
agtcgttctcagccagttatgaaagttgctgttaaaatgttgaaacctacagccaggtca
agcgaaaagcaggcactgatgtctgaactgaagatcatgacacaccttggcgcccatctc
aatatagtaaatttactaggagcctgtaccaagtcaggaccaatttatattattactgaa
tactgcttttatggtgaccttgtgaattacctgcataagaaccgggataattttcagagc
cgacatccagagaaaccaaagaaggacttggatatctttgggctgaacccagctgacgaa
agcacaagaagctatgttattttatcatttgaaaacaatggcgactacatggacatgaaa
caggctgacaccatgcagtatgtaccaatgctggaaatgaatgaaccctccaagtattca
gatatccagagatccctgtatgaccgccctgcatcgtacaagaagaagcctttgtcagaa
gtaaaaaatatcctgtctgatgatggattcgagggtttaacagtactggacttgctcagt
ttcacataccaagttgcacgaggcatggagttcttagcctctaaaaattgtgtacatcgg
gatttggcagctcgaaatgtcctattagcacatgggaaaattgtgaaaatttgtgacttt
ggtctagcgagagacatcatgcacgactccaactatgtatccaaaggcagcacttttctt
ccagtgaaatggatggcacctgaaagcatctttgataacctgtacacaactctcagcgat
gtgtggtcatttggaatcctgctgtgggagatattctctcttgggggcacaccataccct
ggcatgattgtagactcaactttctataataagataaaaagtggctacagaatggcaaaa
cctgaccatgccacccatgaagtgtacgacatcatggtaaaatgctggaacagtgaacca
gaaaaaaggccatcatttcgccatctgagtgacattgttgaaagtctacttcctatggaa
tacaaaaggtgctacgagacagttcttcacgatttccttaaaagtgatcaccctgcagtt
actcgcatgagaagtgacagtgacaattcctacattggggtgacgtataaaaatgaacac
aaaatgaaggacagagagagtgggtttgatgagcagaggctgagtgctgacagcggttac
attattccccttcctgatattgaccccgtctcagatgatgagtccggcaagaggaacagg
cacagttctcagacatcagaagagagtgcaatcgagactggttccagcagttccactttt
ataaagagggatgatgagaccattgaagacattgatatgatggatgacattgggattgat
tcctcggatctagtggaggacagtttcctgtga

DBGET integrated database retrieval system