KEGG   Xenopus laevis (African clawed frog): 108706939
Entry
108706939         CDS       T01010                                 

Gene name
cdkn2b.S, cdk4l, ink4b, mts2, p15, p15ink4b, tp15
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) S homeolog
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108706939 (cdkn2b.S)
   04068 FoxO signaling pathway
    108706939 (cdkn2b.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108706939 (cdkn2b.S)
   04218 Cellular senescence
    108706939 (cdkn2b.S)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 108706939
NCBI-ProteinID: XP_018099263
Xenbase: XB-GENE-17343508
UniProt: A0A1L8HP31
LinkDB
Position
1S
AA seq 125 aa
MDFNANTLCCASARGDVDLARQILQSGIPVNAPNSHGRTPIQVMMMGSPQMAELLLDQGA
DPNVPDPSTGTCPAHDAAREGFLDTLLVLLRNGASLYAPLDNYGQRPIDLASPYLKSKLL
LLGYH
NT seq 378 nt   +upstreamnt  +downstreamnt
atggatttcaatgccaacacactgtgctgtgctagtgcccggggggatgtggatctggca
agacagatactacagagtggtatcccagtaaatgccccaaactctcacggaaggacccca
atacaggtcatgatgatgggtagtcctcagatggctgaactgctgcttgatcagggtgct
gacccaaatgttcctgaccccagtacaggaacctgcccagctcatgacgcagcccgtgaa
ggttttttggacactctgctagtgctgcttaggaatggggcaagtctctacgcaccactg
gacaactatggtcagcgacccatagacctggcttcaccatacctaaaatctaaattactg
ctgctaggatatcactga

KEGG   Xenopus laevis (African clawed frog): 779240
Entry
779240            CDS       T01010                                 

Gene name
cdkn2b.L, cdk4l, cdkn2b, ink4b, mts2, p15, p15ink4b, tp15
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) L homeolog
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    779240 (cdkn2b.L)
   04068 FoxO signaling pathway
    779240 (cdkn2b.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    779240 (cdkn2b.L)
   04218 Cellular senescence
    779240 (cdkn2b.L)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 779240
NCBI-ProteinID: NP_001090330
Xenbase: XB-GENE-6252794
UniProt: Q0IHF2
LinkDB
Position
1L
AA seq 125 aa
MDFNANTLCCASARGDVNLARQMLQSGIPVNAPNSHGRTPIQVMMMGSPQMAELLLDYGA
DPSVPDPSTGTCPTHDAAREGFLDTLLVLLRNGANLYEPRDNYGQRPIDLASPDLKAKLL
LLGYR
NT seq 378 nt   +upstreamnt  +downstreamnt
atggatttcaatgccaacacactgtgctgtgctagtgcccggggtgatgtgaatctggca
agacagatgctacagagtggtatcccagtaaatgccccaaactctcatggaaggacccca
atccaggtcatgatgatgggcagtcctcaaatggctgaattgctgctggattacggcgct
gacccaagtgttcctgaccccagtacaggaacctgcccaactcatgatgcagcccgtgaa
ggctttttggacactctgctagtgctgctgaggaatggggcaaatctctacgaaccacgg
gacaactatggtcagcgacccatagacctggcttcaccagacctaaaagcaaaattactg
ttgctaggatatcgctga

DBGET integrated database retrieval system