KEGG   Xenopus laevis (African clawed frog): 108707229Help
Entry
108707229         CDS       T01010                                 

Gene name
pcsk1.S
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1 S homeolog
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    108707229 (pcsk1.S)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    108707229 (pcsk1.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108707229 (pcsk1.S)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S8: subtilisin family
   108707229 (pcsk1.S)
Chaperones and folding catalysts [BR:xla03110]
 Intramolecular chaperones
  Subtilisin family
   108707229 (pcsk1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane
Motif
Other DBs
NCBI-GeneID: 108707229
NCBI-ProteinID: XP_018099852
Xenbase: XB-GENE-6488900
UniProt: A0A1L8HR72
LinkDB All DBs
Position
1S
AA seq 741 aa AA seqDB search
MEGGHWQHLCIASVALLCLLCRGLEAALDKHFVNEWAAEIPGGPEEAQLLAEELGYDYMG
QIGSLENHYLFRHRAHPRRSRRSAPHITKRLADDGRVSWAEQQYNKERNKRSAIKEDTKN
LFKDPLWNRQWYLQDTRSNPSLPKLDLHLLPVWKRGITGKGVVITVLDDGLEWNHTDIYA
NYDPEASYDFNDNDNDPFPRYDITNENRHGTRCVGEIAMIANNNKCGVGVAYNAKVGGIR
MLDGIVTDAKEASSIGFNPQHVHIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGK
GSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGD
YTDQRIISADLHNECTETHTGTSASAPLAAGIFALALEFNPDLTWRDMQHLVVWTSEYDP
LSNNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWKGVAEKKECIVEDNEFSPRFL
RSDGEVTIQIPTKACEGQDNHIKSLEHLQLEATIEYTRRGDLHITLTSPLGTNTVLLTER
ERDKSPNGFKSWDFMSVHTWGEDPAGTWTVKISDVSGRKNNEGRIVSWKLILRGTSTQPE
HMKYPRVYTSYNVVQNDRRGVEKMGDTEKEPINESVTTDRSEVTENTPDSQELDERAKSL
AIAHLLKNAFDRGEASFPLEEKDIPKHSYLYALATIKQAEGREKENNLYNEYIDRFYHTR
PYKHRDDRLLQALLNILKKKP
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggacattggcagcacctgtgcattgcttcagtcgcactgttgtgcttgttg
tgtcgggggctggaggctgcgctggataaacactttgtcaatgaatgggcagcagagatc
cccggggggccagaggaagcccagttacttgcagaggagttgggttatgattacatggga
cagattggatcgttagaaaatcactacctgttcagacacagagctcatccaagaagatcc
cgcagaagtgcccctcacattactaagagactagctgatgatggacgggtgtcgtgggct
gaacagcagtacaacaaggagagaaataagcggtcggccattaaagaagacaccaaaaac
ttgtttaaagatcccctgtggaatcgacaatggtacttgcaagacacaagatcgaatcct
tcattgcctaagttggatttacatctcctgcctgtatggaagagaggaataacaggcaaa
ggtgttgttatcactgtgctggatgatggcttggaatggaaccacactgatatctatgcc
aattacgatccagaagcaagttacgatttcaatgacaacgacaatgaccccttccccaga
tatgatataacaaatgaaaatagacatggaacaagatgcgtcggggaaattgcgatgatt
gccaacaacaataaatgtggcgttggagttgcatataatgcaaaggttgggggcatacgg
atgctggatggtattgtgacagatgccaaagaagcaagttccattggcttcaatccacaa
catgtgcatatatacagtgccagctggggacctaatgatgatggcaaaactgtagaagga
cctggcagactggcgcagaaagcttttgagtatggcatcaaacaggggcgaaatggaaaa
ggttccatctttgtttgggcatctggaaatggcggccgtcagggtgataactgtgactgt
gatggatacacagacagcatttacaccatctctatcagcagtgcttcccagcaaggtctg
tctccctggtatgcggagaaatgctcttccaccctggctacagcatatagcagtggggac
tacactgatcagagaattataagtgctgacttacacaatgagtgcacggagacgcacact
ggaacctcggcgtcagcaccattggctgctgggatctttgctcttgcactggaatttaac
cctgaccttacctggagggacatgcagcacctggtggtttggacatcagagtacgaccca
ttgtctaacaatcctggttggaagaaaaatggtgctggattaatggttaacagcaggttt
ggatttgggctgctcaatgctaaggcacttgtggatttagctgatcctaaaacatggaaa
ggagttgctgaaaagaaagagtgtatagttgaagataatgaattttcaccaaggtttcta
agatctgatggggaagtaaccatacaaattccaacaaaagcctgcgaaggccaagataat
catatcaaatctctggagcacttgcagctggaagccaccattgaatacacccggagaggg
gaccttcacattacactcacctctccattagggactaatacagttcttctgacggaaaga
gagagagataaatctccaaatggtttcaagagctgggactttatgtctgttcatacatgg
ggagaagatccagcaggaacctggacagtgaaaatatctgatgtgtctggaagaaagaat
aatgaaggaagaatcgtcagctggaaattaattcttcgtggtacatctacccaaccagag
catatgaaatatccaagagtttatacttcctacaatgttgttcaaaatgatcgaaggggt
gttgagaagatgggtgacactgaaaaggaaccaatcaatgaaagtgttacaactgaccgg
tcagaagtcactgaaaacactccagacagccaagaattggatgaaagggcaaagtcgcta
gcaatagcccatcttttgaaaaatgccttcgacagaggagaagcttcatttccgctggaa
gaaaaagatatacctaaacatagttatctgtatgctttggccaccattaagcaggcagaa
ggaagggaaaaagagaacaatctgtacaatgaatacattgacaggttctaccataccaga
ccttacaaacacagagatgatagactattgcaagctttgttaaacattttaaagaagaaa
ccctaa

DBGET integrated database retrieval system