KEGG   Xenopus laevis (African clawed frog): 108708888
Entry
108708888         CDS       T01010                                 

Gene name
nos2.S, nos2a
Definition
(RefSeq) nitric oxide synthase 2 S homeolog
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00220  Arginine biosynthesis
xla00330  Arginine and proline metabolism
xla01100  Metabolic pathways
xla04020  Calcium signaling pathway
xla04146  Peroxisome
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108708888 (nos2.S)
   00330 Arginine and proline metabolism
    108708888 (nos2.S)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108708888 (nos2.S)
   04020 Calcium signaling pathway
    108708888 (nos2.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108708888 (nos2.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108708888 (nos2.S)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Rcd1
Other DBs
NCBI-GeneID: 108708888
NCBI-ProteinID: XP_018104038
Xenbase: XB-GENE-6489041
LinkDB
Position
2S
AA seq 1160 aa
MMCPWKRFMKIGTVTEKVSSNEMDINNNLPKDFGKTHSKITKEAIDFNGTKQTMAEIESI
SENRFPEKIKQSQKRETCPKYLKLKNFENGSIFQDTLHLKAKKNLSCQSKICQGSIMNPK
VYIRGPRTEPVAQEELLPQAIEFVNQYYSSFKEPQIENHLNRLETVAKEIECTGTYQLTK
DELVYASKMAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFNHLCHHITYSSNRGNIRST
ITVFPQRTDGKHDFRVWNSQLIRYAGFQMPDGSILGDPASIEFTELCIHLGWKPKYSRFE
ILPLVLQANGQDPELFVIPSDIIDEVPIEHPKYEWFKELGLRWFTLPAVANMLLEAGGLE
FSACPFNGWYMGTEIGVRDFCDVQRYNVLEEVGRRLGLETHKLASLWKDQAVVELNIAVL
YSFQKHNVTIMDHHSAAESFMKHLENEYRLRGGCPADWVWLVPPMSGSITPVFHQEMLNY
ILSPFYYYQIDAWKTHVWQDENRKPKKKEFKFSVVAKSVLFASSLLKKTLAARRKVTILY
ATETGKSETFAKKLQALFSYAFNAKALCMDDYNIRILEDETLLLVVTSTFGNGDCPGNGE
KFKKAMFSYKELKNKLRYAIFGLGSSMYPQFCAFAHTIDQRLAQLGATQISITGEGDELS
GQEEAFLNWAVQTFKAACELFKIRDRHNIHLPKCYTSTETWNAANYRLVNDNQPYDHIKA
LCKMHSRSILPMKLRFRQNLQSPKSSRATLLVKLSYENSQEIRYMPGEHVGLFAGNQPEL
VTSIIGLLKDAPPCNQHIRLETRNEQESFWTISEKIPPCSLTQALTYFLDITTPPTQLLL
KKLSLLATDITDKSRLEELSKNSDEYNQWKNHNFPNFLEVLEEFPSLHVPTTFVLTQLPP
LKPRYYSISSSNDMVPGEVHLTVAVVSYMTRGGQGPLHHGVCSTWLNTLKINETVPCFIR
STNTFHLPENPSLPCVLIGPGTGISPFRGFWQQRLYDLENKGIRPGSMILLFGCQQSGMD
EIYVDETTHMKSKGILKDVYTAYSRQPGQAKVYVQDILIKNLESEVCRILLEEEGHLYVC
GNFDMAKDVVQTLKHMIAKRLRLNDEETESYFSQLKNKLRYHEDTFGPVHKPQQSTNGNH
SPVAFSTPDYTVHHRIKNME
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgatgtgcccctggaaacggttcatgaagatcggaactgttacagaaaaagtgtcttcc
aatgaaatggacataaacaataatctgcctaaagactttggaaaaacacacagcaaaatc
acaaaagaagcaatcgacttcaatggcacgaagcaaacaatggctgagattgaatctata
tcagagaacagatttccagaaaaaatcaagcaatcgcagaaaagagaaacctgtcctaaa
tatttgaaactgaagaattttgaaaatggatcaatcttccaggacacgttacacctcaaa
gcaaagaagaacctcagctgccaatctaaaatatgtcagggatccattatgaacccaaag
gtttatataagaggccccaggactgagccagtggcacaagaggaacttttgcctcaagca
attgaatttgttaaccagtactacagctccttcaaagagcctcaaatagaaaaccacctc
aacaggctggaaacagtggccaaagaaatagaatgtaccggcacctaccagctaactaaa
gatgagcttgtctatgcatccaagatggcttggagaaatgcaccccggtgcattggacga
atacagtggtctaacttacaggtttttgatgctcgtgactgcaagacagccaaggaaatg
tttaatcacctctgccatcatataacttactcgtccaatagaggaaacataagatctact
attaccgtatttcctcagaggaccgatgggaaacatgattttagagtgtggaacagtcaa
ctgattcgttacgcaggttttcaaatgccagatggatcaatccttggtgacccagccagt
atagaatttacagagttgtgtatccatcttggatggaagccaaaatacagtcggtttgag
atcctccctttggtgcttcaggccaatgggcaagatccggagttgtttgtgataccatca
gatattatcgatgaagtaccaatagaacacccaaagtatgagtggttcaaggaacttggc
ttgaggtggtttacgttacctgcagttgccaatatgcttcttgaagctggaggtttagag
ttctctgcttgtccattcaacggctggtacatgggaacagaaattggtgtgcgggatttc
tgtgacgttcagcgctataatgtgcttgaggaagtaggaaggcggctgggtttagagaca
cacaaactggcttcattgtggaaagaccaagccgttgtggagctcaacattgccgttcta
tatagttttcagaaacacaatgtaaccattatggatcaccactctgcagcggagtccttt
atgaagcacctggagaatgagtaccggctgcgaggaggttgcccagctgactgggtttgg
ctcgtccctccgatgtcaggcagcatcacgccagtgtttcaccaggaaatgctcaattac
attctaagcccattttattactatcagattgatgcttggaaaactcacgtgtggcaggat
gaaaaccgtaaaccaaagaagaaggaattcaagtttagtgtggtggcaaagtctgtgctg
tttgcttcctcactcttaaagaaaactttggctgccagaagaaaagtaaccatcctctat
gcaacagaaacggggaaatcggaaacttttgcaaagaaactgcaagcactgttcagttat
gccttcaatgccaaggctctctgtatggatgactataacatcagaattttggaggatgaa
acccttttactggtggtgacaagtactttcggtaatggagactgcccaggaaatggagag
aaattcaagaaagcaatgttttcttacaaagagctaaaaaacaaattaaggtatgctatt
tttggccttggatccagcatgtacccacagttctgtgcgtttgcccatacaatagaccaa
aggctggcacagcttggtgccacacaaatcagcattacgggtgaaggagatgagctcagt
gggcaggaagaggctttcctaaactgggcagttcaaacatttaaggctgcatgtgaactc
tttaaaattcgagacagacacaacattcatttaccaaagtgttacacctcaacagaaaca
tggaatgcagcaaattatcgtcttgttaatgataaccaaccatatgaccacatcaaagcg
ctctgtaaaatgcactccaggagcatactgccaatgaaactcagatttaggcagaatttg
caaagccccaagtccagccgtgccacgctgcttgtgaagctttcctatgagaatagccag
gaaatacggtatatgccaggagaacatgttggtttgtttgctggcaatcagccagagtta
gtaacgagcataattggacttctgaaggatgcgccgccctgcaaccagcatatccgactg
gagacacggaatgagcaggaaagcttctggacaatcagcgaaaaaatccctccctgctct
ttgacacaagcattgacatatttcctagacataactacgccaccgacgcagcttctgctg
aaaaaactctccctgctggctacagacatcacagacaaaagcaggctagaagagttaagc
aagaattcagatgaatacaatcagtggaagaaccataactttcctaacttcctggaggta
ctagaagaatttccatccctgcatgtgcctacaacatttgtgctcactcagctgccacca
ctgaaacccagatactactctatcagttcctcaaatgatatggtgcctggggaggtccat
ctcactgttgctgttgtgagctacatgacaagaggtggccagggcccattacatcatggc
gtctgcagcacatggctaaatactctgaaaatcaatgaaacagttccatgctttattagg
agcacaaacacattccatctcccagaaaatccatcacttccatgtgtactgattggccca
ggaacaggaatttctccattcagaggattttggcagcagagactctatgacttagaaaat
aaaggaataaggcctgggtctatgatattactgtttggctgccagcaatcaggaatggat
gaaatttatgtcgacgagacaacacacatgaagagtaaaggcatactgaaagatgtgtac
actgcgtattccaggcagccaggacaagccaaggtgtatgttcaagatattcttataaag
aacttggagagtgaagtgtgtcggattttgcttgaagaagaaggccatctgtatgtgtgt
ggaaactttgacatggcaaaggatgttgttcagaccctcaagcacatgatagccaagaga
ctgagactaaacgacgaagaaactgagagttatttctctcagctgaagaacaaattaaga
tatcatgaagatacatttgggcctgtgcataagcctcaacaatctacaaatggaaaccat
tctcccgtggcttttagtacaccagactatactgtacaccataggattaaaaatatggag
taa

DBGET integrated database retrieval system