KEGG   Xenopus laevis (African clawed frog): 108709405
Entry
108709405         CDS       T01010                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108709405
   04068 FoxO signaling pathway
    108709405
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108709405
   04115 p53 signaling pathway
    108709405
   04218 Cellular senescence
    108709405
SSDB
Motif
Pfam: CDI ERp29
Other DBs
NCBI-GeneID: 108709405
NCBI-ProteinID: XP_018104684
UniProt: A0A1L8H6B5
LinkDB
Position
2S
AA seq 137 aa
MQSATAILKQASGNKEKACRMLFGPVDHEQLRVDLDEHMQRSNEEAKAKWNFNFATETPL
EGQYDWVKVEKKDLNCSLRESQKENQCQDEATKRCNIIPSYKAFQNCESSSGKRKQKLIT
DFYSVKRRCSPVPSLHD
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcagtcagccacagccatcctcaagcaagcatctgggaataaggaaaaggcttgcaga
atgctttttggccccgtggaccatgaacagctgagagtggaccttgatgaacatatgcag
cgatccaacgaggaagcaaaagctaaatggaactttaactttgccacagaaacgcctctc
gaagggcaatatgattgggtaaaggtagaaaagaaagacttgaattgcagcttacgggaa
agtcaaaaagaaaaccagtgccaagatgaagcgaccaagagatgtaacattatcccatca
tataaagcattccagaattgtgaaagcagctcaggcaaacgaaaacaaaagctgatcaca
gatttttattctgtcaagcggagatgttcacctgtgcccagtcttcacgattga

DBGET integrated database retrieval system